LKB1/STK11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56895

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LKB1/STK11 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LKB1/STK11 Antibody - BSA Free

Western Blot: LKB1/STK11 Antibody [NBP2-56895]

Western Blot: LKB1/STK11 Antibody [NBP2-56895]

Western Blot: LKB1/STK11 Antibody [NBP2-56895] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: LKB1/STK11 Antibody [NBP2-56895]

Immunocytochemistry/ Immunofluorescence: LKB1/STK11 Antibody [NBP2-56895]

Immunocytochemistry/Immunofluorescence: LKB1/STK11 Antibody [NBP2-56895] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Applications for LKB1/STK11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LKB1/STK11

Peutz-Jeghers syndrome (PJS) is a rare hereditary disease characterized by melanocytic macules lips, gastrointestinal hamartomatous polyps and an increased risk for many classes of cancer. LKB1 (also designated STK11 and PJS) has been identified as the gene mutated in PJS. LKB1 is a 433 amino acid Serine/Threonine kinase with strong homology to the Xenopus cytoplasmic protein kinase XEEK1 and weaker similarity to many other protein kinases. LKB1 is ubiquitously expressed and many frameshift, deletion and splicing mutations have been identified in PJS patients. Despite the increased risk of cancer for PJS patients, LKB1 does not appear to play a major role in colorectal, testicular or breast cancers.

Long Name

Serine/threonine Protein Kinase LKB1

Alternate Names

PJS, STK11

Gene Symbol

STK11

Additional LKB1/STK11 Products

Product Documents for LKB1/STK11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LKB1/STK11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LKB1/STK11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LKB1/STK11 Antibody - BSA Free and earn rewards!

Have you used LKB1/STK11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

mTOR Signaling Pathway mTOR Signaling Pathway Thumbnail