LMOD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89396

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LMOD1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LMOD1 Antibody [NBP1-89396]

Immunocytochemistry/ Immunofluorescence: LMOD1 Antibody [NBP1-89396]

Immunocytochemistry/Immunofluorescence: LMOD1 Antibody [NBP1-89396] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
LMOD1 Antibody Immunohistochemistry-Paraffin: LMOD1 Antibody Antibody [NBP1-89396]

Immunohistochemistry-Paraffin: LMOD1 Antibody Antibody [NBP1-89396]

Staining of human liver, pancreas, prostate and tonsil using NBP1-89396 (A) shows similar protein distribution across tissues to independent antibody NBP1-89397 (B).
LMOD1 Antibody - BSA Free Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Analysis in human prostate and liver tissues using NBP1-89396 antibody. Corresponding LMOD1 RNA-seq data are presented for the same tissues.
LMOD1 Antibody - BSA Free Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
LMOD1 Antibody - BSA Free Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Staining of human liver shows no positivity in hepatocytes as expected.
LMOD1 Antibody - BSA Free Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
LMOD1 Antibody - BSA Free Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Immunohistochemistry-Paraffin: LMOD1 Antibody - BSA Free [NBP1-89396]

Staining of human tonsil shows no positivity in non-germinal center cells as expected.
LMOD1 Antibody - BSA Free Western Blot: LMOD1 Antibody - BSA Free [NBP1-89396]

Western Blot: LMOD1 Antibody - BSA Free [NBP1-89396]

Analysis in human prostate and liver tissues using NBP1-89396 antibody. Corresponding LMOD1 RNA-seq data are presented for the same tissues.

Applications for LMOD1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMOD1

LMOD1, also known as Leiomodin-1, has a 600 amino acid long isoform that is 67 kDa and a short 572 amino acid that is 64 kDa, belongs to the tropomodulin family, most commonly found in smooth muscle (heart, skeletal muscle, colon and small intestine), and has a putative membrane-spanning region and 2 types of tandemly repeated blocks. Current research is being performed on several diseases and disorders including thyroiditis, autoimmune thyroiditis, eye disease, graves' disease, hyperthyroidism, goiter, adenoma, breast cancer, retinoblastoma, carcinoma, thyroid hormone metabolism, mccune albright syndrome, bullous pemphigoid thyrotoxicosis, papillary thyroid carcinoma, coronary restenosis, follicular thyroid carcinoma, iodine deficiency, systemic lupus erythematosus, and pituitary adenom Interactions with this protein have been shown to involve ACTB, MYH11, TLN1, TPM1 and VCL proteins in smooth muscle contraction and muscle contraction pathways.

Alternate Names

64 kDa autoantigen 1D, 64 kDa autoantigen 1D3,1D, 64 kDa autoantigen D1,64kD, D1, FLJ55689, leimodin 1 (smooth muscle), leiomodin 1 (smooth muscle), Leiomodin, muscle form, leiomodin-1, SM-LMOD, Smooth muscle leiomodin, thyroid and eye muscle autoantigen D1 (64kD), Thyroid-associated ophthalmopathy autoantigen

Gene Symbol

LMOD1

Additional LMOD1 Products

Product Documents for LMOD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LMOD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LMOD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LMOD1 Antibody - BSA Free and earn rewards!

Have you used LMOD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...