LSM14A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56784

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LSM14A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LSM14A. Peptide Sequence KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for LSM14A Antibody - BSA Free

Western Blot: LSM14A Antibody [NBP1-56784]

Western Blot: LSM14A Antibody [NBP1-56784]

Western Blot: LSM14A Antibody [NBP1-56784] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: LSM14A Antibody [NBP1-56784]

Immunohistochemistry: LSM14A Antibody [NBP1-56784]

Immunohistochemistry: LSM14A Antibody [NBP1-56784] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and plasma membrane in hepatocytes and sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: LSM14A Antibody [NBP1-56784]

Western Blot: LSM14A Antibody [NBP1-56784]

Western Blot: LSM14A Antibody [NBP1-56784] - 721_B Cell Lysate 1.0ug/ml, Gel Concentration 12%
Western Blot: LSM14A Antibody [NBP1-56784]

Western Blot: LSM14A Antibody [NBP1-56784]

Western Blot: LSM14A Antibody [NBP1-56784] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: LSM14A Antibody [NBP1-56784]

Western Blot: LSM14A Antibody [NBP1-56784]

Western Blot: LSM14A Antibody [NBP1-56784] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Hela cell lysate

Applications for LSM14A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LSM14A

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM].

Alternate Names

AlphaSNBP, C19orf13, DKFZp434D1335, FAM61A, family with sequence similarity 61, member A, hRAP55, hRAP55A, LSM14 homolog A, LSM14A, SCD6 homolog A (S. cerevisiae), Protein FAM61A, protein LSM14 homolog A, Protein SCD6 homolog, Putative alpha-synuclein-binding protein, RAP55ALSM14 homolog A (SCD6, S. cerevisiae), RAP55chromosome 19 open reading frame 13, RNA-associated protein 55, RNA-associated protein 55A

Gene Symbol

LSM14A

UniProt

Q8ND56 (Human)

Additional LSM14A Products

Product Documents for LSM14A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LSM14A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LSM14A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LSM14A Antibody - BSA Free and earn rewards!

Have you used LSM14A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies