Lymphotoxin beta/TNFSF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14207

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Lymphotoxin beta/TNFSF3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunocytochemistry/ Immunofluorescence: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunocytochemistry/Immunofluorescence: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human cell line RT4 shows localization to centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human small intestine shows moderate positivity in leukocytes.
Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non germinal and germinal center cells.
Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human cerebral cortex shows very weak positivity in neurons.
Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207]

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human tonsil shows moderate positivity in non-germinal center cells.

Applications for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lymphotoxin beta/TNFSF3

Tumor necrosis factor (TNF) and lymphotoxin-alpha (LT-alpha, also known as TNF beta) are members of a family of secreted and cell surface cytokines that participate in the regulation of immune and inflammatory responses. LT-beta (lymphotaxin-beta or tumor necrosis factor C) is a type II membrane protein with significant homology to TNF, LT-alpha, and the ligand for the CD40 receptor. LT-alpha is present on the surface of activated T, B, and LAK cells as a complex with the 33 kda glycoprotein, LT-beta. LT-beta, also expressed by active lymphocytes, forms a heterotrimer with LT-a on the cell surface and anchors LT-alpha to the cell surface. A TNF receptor-related protein, the LT-beta receptor (also known as TNFC receptor), is the human receptor for the LT-alpha/LT-beta heterotrimer. There are two LT-beta isoforms expressed in human lymphoid cell lines and non-Hodgkin's lymphomas. The gene which encodes LT-beta maps to the major histocompatibility complex region on human chromosome 6p21.3.

Long Name

Lymphotoxin beta

Alternate Names

LTB, TNFSF3

Gene Symbol

LTB

Additional Lymphotoxin beta/TNFSF3 Products

Product Documents for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lymphotoxin beta/TNFSF3 Antibody - BSA Free and earn rewards!

Have you used Lymphotoxin beta/TNFSF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies