Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92982

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 (NP_001017426.1). LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

176 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of mouse brain, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST
Immunocytochemistry/ Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free [NBP2-92982]

Immunocytochemistry/ Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free [NBP2-92982]

Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of U2OS cells using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of various cell lines, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3.Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free [NBP2-92982]

Immunocytochemistry/ Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free [NBP2-92982]

Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of NIH/3T3 cells using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lysine (K)-specific Demethylase 6B/KDM6B

JMJD3 is a histone demethylase that specifically demethylates trimethylated and dimethylated 'Lys-27' of histone H3, thereby playing a central role in histone code. JMJD3 is also important for the regulation of posterior development by regulating HOX gene expression. JMJD3 is involved in inflammatory response by participating in macrophage differentiation in case of inflammation by regulating gene expression and macrophage differentiation. It has also been shown to be essential to mammalian epidermal differentiation and is upregulated in prostate cancer.

JMJD3 antibodies are useful tools for epigenetics research and specifically for histone modification studies.

Alternate Names

JMJD3, KDM6B, Lysine (K)specific Demethylase 6B

Gene Symbol

KDM6B

Additional Lysine (K)-specific Demethylase 6B/KDM6B Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

Customer Reviews

There are currently no reviews for this product. Be the first to review Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free and earn rewards!

Have you used Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...