Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17883

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free

Western Blot: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883]

Western Blot: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883]

Western Blot: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG
Immunocytochemistry/ Immunofluorescence: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883]

Immunocytochemistry/ Immunofluorescence: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883]

Immunocytochemistry/Immunofluorescence: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883] - Staining of human cell line U-2 OS shows localization to vesicles.

Applications for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lysosomal Pro-X Carboxypeptidase/PRCP

PRCP is encoded by this gene is a lysosomal prolylcarboxypeptidase, which cleaves C-terminal amino acids linked to proline in peptides such as angiotension II, III and des-Arg9-bradykinin. The cleavage occurs at acidic pH, but the enzyme activity is retained with some substrates at neutral pH. This enzyme has been shown to be an activator of the cell matrix-associated prekallikrein. The importance of angiotension II, one of the substrates of this enzyme, in regulating blood pressure and electrolyte balance suggests that this gene may be related to essential hypertension. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Alternate Names

Angiotensinase C, HUMPCP, Prolylcarboxypeptidase

Gene Symbol

PRCP

Additional Lysosomal Pro-X Carboxypeptidase/PRCP Products

Product Documents for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free and earn rewards!

Have you used Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...