Mammaglobin B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87736

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Mammaglobin B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Mammaglobin B Antibody - BSA Free

Western Blot: Mammaglobin B Antibody [NBP1-87736]

Western Blot: Mammaglobin B Antibody [NBP1-87736]

Western Blot: Mammaglobin B Antibody [NBP1-87736] - Analysis in control (vector only transfected HEK293T lysate) and SCGB2A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining in human cervix, uterine and testis tissues using anti-SCGB2A1 antibody. Corresponding SCGB2A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining of human cervix, uterine shows high expression.
Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining of human testis shows low expression as expected.

Applications for Mammaglobin B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Mammaglobin B

Secretoglobins (also called lipophilins or mammaglobins) are small secreted proteins of endocrine-responsive organs and mucosal epithelia that form multimeric complexes and correlate with the development of various human cancers. Lipophilin A and Lipophilin B are orthologs of prostatein (estramustine- binding protein), the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin A, also designated LIPA, LPHA and secretoglobin, family 1D, member 1 (SCGB1D1), is a component of a heterodimeric molecule present in human tears. Lipophilin B, also designated LIPB, LPHB and secretoglobin, family 1D, member 2 (SCGB1D2), mRNA can be overexpressed in breast tumors and shows a high degree of correlation with the mRNA expression profile of mammaglobin. Histological detection in breast tissue of Mammaglobin A, also designated MGB1 and secretoglobin, family 2A, member 2 (SCGB2A2) and Mammaglobin B, also designated MGB2, Lipophilin C, LPHC, UGB3 and SCGB2A2, is a reliable diagnostic marker for breast tumors

Alternate Names

lacryglobin, LIPHC, lipophilin C, lipophilin-C, LPHC, mammaglobin 2, mammaglobin B, Mammaglobin-2, MGB2mammaglobin-B, MGC71973, Secretoglobin family 2A member 1, secretoglobin, family 2A, member 1, UGB3mammaglobin-2

Gene Symbol

SCGB2A1

Additional Mammaglobin B Products

Product Documents for Mammaglobin B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Mammaglobin B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Mammaglobin B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mammaglobin B Antibody - BSA Free and earn rewards!

Have you used Mammaglobin B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies