Matrin 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38211

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Matrin 3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 747-847 of human Matrin 3 (NP_001181884.1).

Sequence:
SSENADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEERRQKKET

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Matrin 3 Antibody - BSA Free

Matrin 3 Antibody

Immunocytochemistry/ Immunofluorescence: Matrin 3 Antibody [NBP3-38211] -

Immunocytochemistry/ Immunofluorescence: Matrin 3 Antibody [NBP3-38211] - Immunofluorescence analysis of C6 cells using Matrin 3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Matrin 3 Antibody

Immunohistochemistry: Matrin 3 Antibody [NBP3-38211] -

Immunohistochemistry: Matrin 3 Antibody [NBP3-38211] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using Matrin 3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Matrin 3 Antibody

Immunohistochemistry: Matrin 3 Antibody [NBP3-38211] -

Immunohistochemistry: Matrin 3 Antibody [NBP3-38211] - Immunohistochemistry analysis of paraffin-embedded Rat testis using Matrin 3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Matrin 3 Antibody

Immunocytochemistry/ Immunofluorescence: Matrin 3 Antibody [NBP3-38211] -

Immunocytochemistry/ Immunofluorescence: Matrin 3 Antibody [NBP3-38211] - Immunofluorescence analysis of NIH/3T3 cells using Matrin 3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Matrin 3 Antibody

Western Blot: Matrin 3 Antibody [NBP3-38211] -

Western Blot: Matrin 3 Antibody [NBP3-38211] - Western blot analysis of various lysates using Matrin 3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Matrin 3 Antibody

Immunohistochemistry: Matrin 3 Antibody [NBP3-38211] -

Immunohistochemistry: Matrin 3 Antibody [NBP3-38211] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Matrin 3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Matrin 3 Antibody

Immunocytochemistry/ Immunofluorescence: Matrin 3 Antibody [NBP3-38211] -

Immunocytochemistry/ Immunofluorescence: Matrin 3 Antibody [NBP3-38211] - Immunofluorescence analysis of U-2 OS cells using Matrin 3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Matrin 3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:100 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Matrin 3

Matrin 3 is encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.

Alternate Names

distal 2, DKFZp686K0542, DKFZp686K23100, matrin 3, matrin-3, vocal cord and pharyngeal weakness with distal myopathy

Gene Symbol

MATR3

Additional Matrin 3 Products

Product Documents for Matrin 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Matrin 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Matrin 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Matrin 3 Antibody - BSA Free and earn rewards!

Have you used Matrin 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies