MCM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33954

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MCM2 Antibody - BSA Free

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954] - Staining in human lymph node and kidney tissues using anti-MCM2 antibody. Corresponding MCM2 RNA-seq data are presented for the same tissues.
Western Blot: MCM2 Antibody [NBP2-33954]

Western Blot: MCM2 Antibody [NBP2-33954]

Western Blot: MCM2 Antibody [NBP2-33954] - Analysis in human cell line HEL.
Immunocytochemistry/ Immunofluorescence: MCM2 Antibody [NBP2-33954]

Immunocytochemistry/ Immunofluorescence: MCM2 Antibody [NBP2-33954]

Immunocytochemistry/Immunofluorescence: MCM2 Antibody [NBP2-33954] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954]

Immunohistochemistry-Paraffin: MCM2 Antibody [NBP2-33954] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Applications for MCM2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCM2

MCM2 is encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7.

Long Name

Minichromosome Maintenance Protein 2

Alternate Names

BM28, CCNL1, cdc19, CDCL1, D3S3194, Mitotin

Gene Symbol

MCM2

UniProt

Additional MCM2 Products

Product Documents for MCM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MCM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MCM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCM2 Antibody - BSA Free and earn rewards!

Have you used MCM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...