MEK2 Recombinant Protein Antigen

Name: MEK2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38660PEP
Price: 279 USD
Availability: InStock

Novus Biologicals | Catalog # NBP2-38660PEP

Submit a review

Product Documents

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas
Related Blogs

Key Product Details

Source

E. coli

Applications

Antibody Competition

View all MEK2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP2K2.

Source: E. coli

Amino Acid Sequence: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38660.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-38660PEP

Formulation	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -20C. Avoid freeze-thaw cycles.

Background: MEK2

MEK1 and MEK2 (MAPK kinase 1/2, or ERK kinase 1/2) are mitogen-activated protein kinases that stimulate MAP kinase activity, playing a role in both cell growth and differentiation (1,2). MEK itself is activated via phosphorylation at serines 217/218 and 221/222 by upstream activator kinases, including c-raf, mos and MEK kinase (3,4). MEK1 and MEK2 are activated by a wide variety of growth factors and cytokines, and also by membrane depolarization and calcium influx (5).

Long Name

Mitogen-activated Protein Kinase Kinase 2

Alternate Names

MAP2K2, MKK2

Gene Symbol

MAP2K2

Additional MEK2 Products

Product Documents for MEK2 Recombinant Protein Antigen

Download Product Datasheets

Download Antigen Blocking Protocol

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MEK2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.