Melanocortin-3 R/MC3R Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10027

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Melanocortin-3 R/MC3R (NP_063941.3). Peptide sequence PTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Melanocortin-3 R/MC3R Antibody - BSA Free

Western Blot: Melanocortin-3 R/MC3R Antibody [NBP3-10027]

Western Blot: Melanocortin-3 R/MC3R Antibody [NBP3-10027]

Western Blot: Melanocortin-3 R/MC3R Antibody [NBP3-10027] - Western blot analysis of Melanocortin-3 R/MC3R in Human ACHN Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for Melanocortin-3 R/MC3R Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Melanocortin-3 R/MC3R

Melanocortins are ligands for a subgroup of GPCRs positively coupled to Adenylate cylcases, termed as melanocortin receptors (MC1R, MC2R, MC3R, MC4R amd MC5R). These receptors are widely expressed at varied density throughout the body. The MC3R has been widely implicated in inflammation and is also implicated in a role in obesity and metabolism. MC3R KO mice exhibit reduced linear growth and lean mass and are hyperleptinemic and hyperinsulinemic.

Long Name

Melanocortin 3 Receptor

Alternate Names

MC3R, Melanocortin-3R, Melanocortin3R

Gene Symbol

MC3R

Additional Melanocortin-3 R/MC3R Products

Product Documents for Melanocortin-3 R/MC3R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Melanocortin-3 R/MC3R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Melanocortin-3 R/MC3R Antibody - BSA Free

Customer Reviews for Melanocortin-3 R/MC3R Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Melanocortin-3 R/MC3R Antibody - BSA Free and earn rewards!

Have you used Melanocortin-3 R/MC3R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...