Methionine Sulfoxide Reductase A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57727

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Methionine Sulfoxide Reductase A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MSRA (methionine sulfoxide reductase A) The peptide sequence was selected from the middle region of MSRA)(50ug). Peptide sequence YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Methionine Sulfoxide Reductase A Antibody - BSA Free

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP1-57727]

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP1-57727]

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP1-57727] - Human Lung lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: Methionine Sulfoxide Reductase A Antibody [NBP1-57727]

Immunohistochemistry: Methionine Sulfoxide Reductase A Antibody [NBP1-57727]

Immunohistochemistry: Methionine Sulfoxide Reductase A Antibody [NBP1-57727] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for Methionine Sulfoxide Reductase A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Methionine Sulfoxide Reductase A

This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.

Alternate Names

cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase

Gene Symbol

MSRA

UniProt

Q9UJ68 (Human)

Additional Methionine Sulfoxide Reductase A Products

Product Documents for Methionine Sulfoxide Reductase A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Methionine Sulfoxide Reductase A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Methionine Sulfoxide Reductase A Antibody - BSA Free

Customer Reviews for Methionine Sulfoxide Reductase A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Methionine Sulfoxide Reductase A Antibody - BSA Free and earn rewards!

Have you used Methionine Sulfoxide Reductase A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies