Methionine Sulfoxide Reductase B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03548

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human Methionine Sulfoxide Reductase B (NP_057416.1). MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Methionine Sulfoxide Reductase B Antibody - BSA Free

Western Blot: Methionine Sulfoxide Reductase B AntibodyBSA Free [NBP3-03548]

Western Blot: Methionine Sulfoxide Reductase B AntibodyBSA Free [NBP3-03548]

Western Blot: Methionine Sulfoxide Reductase B Antibody [NBP3-03548] - Analysis of extracts of various cell lines, using Methionine Sulfoxide Reductase B antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548]

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548]

Immunocytochemistry/Immunofluorescence: Methionine Sulfoxide Reductase B Antibody [NBP3-03548] - Analysis of HeLa cells using Methionine Sulfoxide Reductase B antibody. Blue: DAPI for nuclear staining.
Methionine Sulfoxide Reductase B Antibody - BSA Free

Immunohistochemistry: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548] -

Immunohistochemistry: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548] - Immunohistochemistry analysis of Methionine Sulfoxide Reductase B in paraffin-embedded Mouse testis tissue using Methionine Sulfoxide Reductase B Rabbit pAb (A6737) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Methionine Sulfoxide Reductase B Antibody - BSA Free

Immunohistochemistry: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548] -

Immunohistochemistry: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548] - Immunohistochemistry analysis of Methionine Sulfoxide Reductase B in paraffin-embedded Rat testis tissue using Methionine Sulfoxide Reductase B Rabbit pAb (A6737) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Methionine Sulfoxide Reductase B Antibody - BSA Free

Immunohistochemistry: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548] -

Immunohistochemistry: Methionine Sulfoxide Reductase B Antibody - BSA Free [NBP3-03548] - Immunohistochemistry analysis of Methionine Sulfoxide Reductase B in paraffin-embedded Human colon tissue using Methionine Sulfoxide Reductase B Rabbit pAb (A6737) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Methionine Sulfoxide Reductase B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Methionine Sulfoxide Reductase B

Methionine Sulfoxide Reductase B encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase B (MsrB) family, and it is expressed in a variety of adult and fetal tissues.

Alternate Names

EC 1.8.4.-, methionine sulfoxide reductase, methionine-R-sulfoxide reductase B1, MGC3344, MsrB1, MSRB1selenoprotein R, Selenoprotein X, selenoprotein X, 1, SELR, SELX

Gene Symbol

MSRB1

Additional Methionine Sulfoxide Reductase B Products

Product Documents for Methionine Sulfoxide Reductase B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Methionine Sulfoxide Reductase B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Methionine Sulfoxide Reductase B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Methionine Sulfoxide Reductase B Antibody - BSA Free and earn rewards!

Have you used Methionine Sulfoxide Reductase B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...