METTL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88386

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for METTL1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: METTL1 Antibody [NBP1-88386]

Immunocytochemistry/ Immunofluorescence: METTL1 Antibody [NBP1-88386]

Immunocytochemistry/Immunofluorescence: METTL1 Antibody [NBP1-88386] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
METTL1 Antibody - BSA Free Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
METTL1 Antibody - BSA Free Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
METTL1 Antibody - BSA Free Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Staining of human cerebral cortex shows no nuclear positivity in neuronal cells as expected.
METTL1 Antibody - BSA Free Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
METTL1 Antibody - BSA Free Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Immunohistochemistry-Paraffin: METTL1 Antibody - BSA Free [NBP1-88386]

Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.

Applications for METTL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: METTL1

METTL1 is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq]

Alternate Names

C12orf1, D1075-like gene product, EC 2.1.1.33, FLJ95748, methyltransferase like 1, methyltransferase-like 1, Methyltransferase-like protein 1, TRM8, tRNA (guanine-N(7)-)-methyltransferase, tRNA(m7G46)-methyltransferase, YDL201w

Gene Symbol

METTL1

Additional METTL1 Products

Product Documents for METTL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for METTL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for METTL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review METTL1 Antibody - BSA Free and earn rewards!

Have you used METTL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...