METTL14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81392

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for METTL14 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP1-81392]

Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP1-81392]

Immunocytochemistry/Immunofluorescence: METTL14 Antibody [NBP1-81392] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Simple Western: METTL14 Antibody [NBP1-81392]

Simple Western: METTL14 Antibody [NBP1-81392]

Simple Western: METTL14 Antibody [NBP1-81392] - Simple Western lane view shows a specific band for METTL14 in 0.2 mg/ml of NIH-3T3 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
METTL14 Antibody - BSA Free

Western Blot: METTL14 Antibody - BSA Free [NBP1-81392] -

Knockdown of METTL14 or inhibition of m6A methylation modification can partially rescue the decline in cell proliferation induced by atRA. qRT-PCR (A) and Western blot (B) detection of the siRNA knockdown efficiency of METTL14. (C) Dot blotting detected the m6A methylation modification level of MEPM cells after treatment with siMETTL14 and atRA. (D) Flow cytometry to detect MEPM cell cycle changes after siMETTL14 and atRA treatments. (E) Western blot detected changes in MEPM cell cycle and proliferation-related proteins after siMETTL14 and atRA treatments. (F) Dot blotting detected m6A methylation modification level after SAH treatment of MEPM. (G) Western blot detection of METTL14 protein expression after SAH treatment of MEPM. (H) CCK8 experiment to detect cell proliferation after SAH and atRA treatments of MEPM. n.s is considered not statistically significant, * means p < 0.05, ** means p < 0.01, *** means p < 0.001, **** means p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/8/4538), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
METTL14 Antibody - BSA Free

Western Blot: METTL14 Antibody - BSA Free [NBP1-81392] -

Increased m6A level and expression of METTL14 in embryonic palatal mesenchyme were associated with cleft palate. (A) Dot blot was used to detect the m6A modification level of RNA in the palatal mesenchyme of embryonic mice in the control group, RA10D group, and RA12D group. (B) qRT-PCR detection of the expression of m6A methylation modification enzymes in the palatal mesenchyme of embryonic mice in the control group and RA10D group. (C) qRT-PCR detection of METTL14 and WTAP mRNA expression and changes in the palatal mesenchyme of the control group and RA10D group on days E13.5–E15.5. (D) Western blot detection of METTL14 expression in the palatal mesenchyme of embryonic mice in the control group and RA10D group. (E,F) Immunofluorescence detection and semi-quantitative analysis of METTL14 expression in the palatal mesenchyme of embryonic mice in the control group and RA10D group from E13.5 to E15.5 days (green: METTL14, blue: DAPI) (10× magnification). n.s is considered not statistically significant, ** means p < 0.01, *** means p < 0.001, **** means p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/8/4538), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
METTL14 Antibody - BSA Free

Western Blot: METTL14 Antibody - BSA Free [NBP1-81392] -

Knockdown of METTL14 or inhibition of m6A methylation modification can partially rescue the decline in cell proliferation induced by atRA. qRT-PCR (A) and Western blot (B) detection of the siRNA knockdown efficiency of METTL14. (C) Dot blotting detected the m6A methylation modification level of MEPM cells after treatment with siMETTL14 and atRA. (D) Flow cytometry to detect MEPM cell cycle changes after siMETTL14 and atRA treatments. (E) Western blot detected changes in MEPM cell cycle and proliferation-related proteins after siMETTL14 and atRA treatments. (F) Dot blotting detected m6A methylation modification level after SAH treatment of MEPM. (G) Western blot detection of METTL14 protein expression after SAH treatment of MEPM. (H) CCK8 experiment to detect cell proliferation after SAH and atRA treatments of MEPM. n.s is considered not statistically significant, * means p < 0.05, ** means p < 0.01, *** means p < 0.001, **** means p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/8/4538), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
METTL14 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: METTL14 Antibody - BSA Free [NBP1-81392] -

Increased m6A level and expression of METTL14 in embryonic palatal mesenchyme were associated with cleft palate. (A) Dot blot was used to detect the m6A modification level of RNA in the palatal mesenchyme of embryonic mice in the control group, RA10D group, and RA12D group. (B) qRT-PCR detection of the expression of m6A methylation modification enzymes in the palatal mesenchyme of embryonic mice in the control group and RA10D group. (C) qRT-PCR detection of METTL14 and WTAP mRNA expression and changes in the palatal mesenchyme of the control group and RA10D group on days E13.5–E15.5. (D) Western blot detection of METTL14 expression in the palatal mesenchyme of embryonic mice in the control group and RA10D group. (E,F) Immunofluorescence detection and semi-quantitative analysis of METTL14 expression in the palatal mesenchyme of embryonic mice in the control group and RA10D group from E13.5 to E15.5 days (green: METTL14, blue: DAPI) (10× magnification). n.s is considered not statistically significant, ** means p < 0.01, *** means p < 0.001, **** means p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/8/4538), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
METTL14 Antibody - BSA Free Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392]

Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392]

Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
METTL14 Antibody - BSA Free Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392]

Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392]

Staining of human kidney shows moderate to strong nuclear positivity in glomeruli and cells in tubules.
METTL14 Antibody - BSA Free Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392]

Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392]

Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Applications for METTL14 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Simple Western

1:20
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 64 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: METTL14

Probable methyltransferase

Long Name

Methyltransferase-Like Protein 14

Alternate Names

KIAA1627

Gene Symbol

METTL14

Additional METTL14 Products

Product Documents for METTL14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for METTL14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for METTL14 Antibody - BSA Free

Customer Reviews for METTL14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review METTL14 Antibody - BSA Free and earn rewards!

Have you used METTL14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...