METTL14 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81392
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Simple Western
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for METTL14 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP1-81392]
Immunocytochemistry/Immunofluorescence: METTL14 Antibody [NBP1-81392] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392]
Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392] - Staining of human kidney shows moderate to strong nuclear positivity in glomeruli and cells in tubules.Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392]
Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392]
Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.Simple Western: METTL14 Antibody [NBP1-81392]
Simple Western: METTL14 Antibody [NBP1-81392] - Simple Western lane view shows a specific band for METTL14 in 0.2 mg/ml of NIH-3T3 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Western Blot: METTL14 Antibody - BSA Free [NBP1-81392] -
Knockdown of METTL14 or inhibition of m6A methylation modification can partially rescue the decline in cell proliferation induced by atRA. qRT-PCR (A) and Western blot (B) detection of the siRNA knockdown efficiency of METTL14. (C) Dot blotting detected the m6A methylation modification level of MEPM cells after treatment with siMETTL14 and atRA. (D) Flow cytometry to detect MEPM cell cycle changes after siMETTL14 and atRA treatments. (E) Western blot detected changes in MEPM cell cycle and proliferation-related proteins after siMETTL14 and atRA treatments. (F) Dot blotting detected m6A methylation modification level after SAH treatment of MEPM. (G) Western blot detection of METTL14 protein expression after SAH treatment of MEPM. (H) CCK8 experiment to detect cell proliferation after SAH and atRA treatments of MEPM. n.s is considered not statistically significant, * means p < 0.05, ** means p < 0.01, *** means p < 0.001, **** means p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/8/4538), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: METTL14 Antibody - BSA Free [NBP1-81392] -
Increased m6A level and expression of METTL14 in embryonic palatal mesenchyme were associated with cleft palate. (A) Dot blot was used to detect the m6A modification level of RNA in the palatal mesenchyme of embryonic mice in the control group, RA10D group, and RA12D group. (B) qRT-PCR detection of the expression of m6A methylation modification enzymes in the palatal mesenchyme of embryonic mice in the control group and RA10D group. (C) qRT-PCR detection of METTL14 and WTAP mRNA expression and changes in the palatal mesenchyme of the control group and RA10D group on days E13.5–E15.5. (D) Western blot detection of METTL14 expression in the palatal mesenchyme of embryonic mice in the control group and RA10D group. (E,F) Immunofluorescence detection and semi-quantitative analysis of METTL14 expression in the palatal mesenchyme of embryonic mice in the control group and RA10D group from E13.5 to E15.5 days (green: METTL14, blue: DAPI) (10× magnification). n.s is considered not statistically significant, ** means p < 0.01, *** means p < 0.001, **** means p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/8/4538), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: METTL14 Antibody - BSA Free [NBP1-81392] -
Knockdown of METTL14 or inhibition of m6A methylation modification can partially rescue the decline in cell proliferation induced by atRA. qRT-PCR (A) and Western blot (B) detection of the siRNA knockdown efficiency of METTL14. (C) Dot blotting detected the m6A methylation modification level of MEPM cells after treatment with siMETTL14 and atRA. (D) Flow cytometry to detect MEPM cell cycle changes after siMETTL14 and atRA treatments. (E) Western blot detected changes in MEPM cell cycle and proliferation-related proteins after siMETTL14 and atRA treatments. (F) Dot blotting detected m6A methylation modification level after SAH treatment of MEPM. (G) Western blot detection of METTL14 protein expression after SAH treatment of MEPM. (H) CCK8 experiment to detect cell proliferation after SAH and atRA treatments of MEPM. n.s is considered not statistically significant, * means p < 0.05, ** means p < 0.01, *** means p < 0.001, **** means p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/8/4538), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: METTL14 Antibody - BSA Free [NBP1-81392] -
Increased m6A level and expression of METTL14 in embryonic palatal mesenchyme were associated with cleft palate. (A) Dot blot was used to detect the m6A modification level of RNA in the palatal mesenchyme of embryonic mice in the control group, RA10D group, and RA12D group. (B) qRT-PCR detection of the expression of m6A methylation modification enzymes in the palatal mesenchyme of embryonic mice in the control group and RA10D group. (C) qRT-PCR detection of METTL14 and WTAP mRNA expression and changes in the palatal mesenchyme of the control group and RA10D group on days E13.5–E15.5. (D) Western blot detection of METTL14 expression in the palatal mesenchyme of embryonic mice in the control group and RA10D group. (E,F) Immunofluorescence detection and semi-quantitative analysis of METTL14 expression in the palatal mesenchyme of embryonic mice in the control group and RA10D group from E13.5 to E15.5 days (green: METTL14, blue: DAPI) (10× magnification). n.s is considered not statistically significant, ** means p < 0.01, *** means p < 0.001, **** means p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/8/4538), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: METTL14 Antibody - BSA Free [NBP1-81392] -
Inhibition of mesenchymal cell proliferation in cleft palate mice may be related to the abnormal expression of METTL14. (A) Western blot detection of the proliferation and cell cycle-related differential genes of palatal mesenchyme cells in the control group and RA10D cleft palate group on days E13.5, E14.5, and E15.5. ki67 immunofluorescence detection of cell proliferation levels in the palatal mesenchyme of embryonic mice in the control and RA10D/R zA12D cleft palate groups on days E13.5 (B), E14.5 (C), and E15.5 (D) (green: ki67, blue: DAPI) (10× magnification). (E) Immunohistochemical detection of METTL14 and PCNA expression in the palatal mesenchyme of embryonic mice in the control group and RA10D cleft palate group. n.s is considered not statistically significant, * means p < 0.05, ** means p < 0.01, *** means p < 0.001, **** means p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/8/4538), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for METTL14 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Simple Western
1:20
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 64 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 64 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: METTL14
Long Name
Methyltransferase-Like Protein 14
Alternate Names
KIAA1627
Gene Symbol
METTL14
Additional METTL14 Products
Product Documents for METTL14 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for METTL14 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for METTL14 Antibody - BSA Free
Customer Reviews for METTL14 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review METTL14 Antibody - BSA Free and earn rewards!
Have you used METTL14 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...