METTL7B Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05106

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all METTL7B Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 165-244 of human METTL7B (NP_689850.2). RPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for METTL7B Antibody - Azide and BSA Free

Western Blot: METTL7B AntibodyAzide and BSA Free [NBP3-05106]

Western Blot: METTL7B AntibodyAzide and BSA Free [NBP3-05106]

Western Blot: METTL7B Antibody [NBP3-05106] - Western blot analysis of extracts of Rat liver, using METTL7B antibody (NBP3-05106) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: METTL7B AntibodyAzide and BSA Free [NBP3-05106]

Western Blot: METTL7B AntibodyAzide and BSA Free [NBP3-05106]

Western Blot: METTL7B Antibody [NBP3-05106] - Western blot analysis of extracts of various cell lines, using METTL7B antibody (NBP3-05106) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
METTL7B Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: METTL7B Antibody - Azide and BSA Free [NBP3-05106] -

Immunocytochemistry/ Immunofluorescence: METTL7B Antibody - Azide and BSA Free [NBP3-05106] - Immunofluorescence analysis of U-251MG cells using METTL7B Rabbit pAb (A7200) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
METTL7B Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: METTL7B Antibody - Azide and BSA Free [NBP3-05106] -

Immunocytochemistry/ Immunofluorescence: METTL7B Antibody - Azide and BSA Free [NBP3-05106] - Immunofluorescence analysis of HepG2 cells using METTL7B Rabbit pAb (A7200) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for METTL7B Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: METTL7B

Probable methyltransferase

Alternate Names

EC 2.1.1, EC 2.1.1.-, methyltransferase like 7B, methyltransferase-like protein 7B, MGC17301

Gene Symbol

TMT1B

Additional METTL7B Products

Product Documents for METTL7B Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for METTL7B Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for METTL7B Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review METTL7B Antibody - Azide and BSA Free and earn rewards!

Have you used METTL7B Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies