MFSD11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-93984

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MFSD11 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFKKSFKLCVTKEML

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MFSD11 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MFSD11 Antibody [NBP1-93984]

Immunocytochemistry/ Immunofluorescence: MFSD11 Antibody [NBP1-93984]

Immunocytochemistry/Immunofluorescence: MFSD11 Antibody [NBP1-93984] - Staining of human cell line A-431 shows localization to nuclear speckles.
MFSD11 Antibody - BSA Free Western Blot: MFSD11 Antibody - BSA Free [NBP1-93984]

Western Blot: MFSD11 Antibody - BSA Free [NBP1-93984]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
MFSD11 Antibody - BSA Free Western Blot: MFSD11 Antibody - BSA Free [NBP1-93984]

Western Blot: MFSD11 Antibody - BSA Free [NBP1-93984]

Analysis in human cell line CAPAN-2.

Applications for MFSD11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MFSD11

Alternate Names

ET, FLJ20226, FLJ22196, major facilitator superfamily domain containing 11, major facilitator superfamily domain-containing protein 11, protein ET, UNC93-like protein MFSD11

Gene Symbol

MFSD11

Additional MFSD11 Products

Product Documents for MFSD11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MFSD11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MFSD11 Antibody - BSA Free

Customer Reviews for MFSD11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MFSD11 Antibody - BSA Free and earn rewards!

Have you used MFSD11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies