MIS18A Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88943
![Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943]](https://resources.rndsystems.com/images/products/MIS18A-Antibody-Immunohistochemistry-Paraffin-NBP1-88943-img0007.jpg "Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MIS18A Antibody - BSA Free
![Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943]](https://resources.rndsystems.com/images/products/MIS18A-Antibody-Immunohistochemistry-Paraffin-NBP1-88943-img0006.jpg "Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943]")
Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943]
Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943] - Staining of human pancreas shows low expression as expected.![Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943]](https://resources.rndsystems.com/images/products/MIS18A-Antibody-Immunohistochemistry-Paraffin-NBP1-88943-img0002.jpg "Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943]")
Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943]
Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts. Sertoli cells are generally negative.![Simple Western: MIS18A Antibody [NBP1-88943]](https://resources.rndsystems.com/images/products/MIS18A-Antibody-Simple-Western-NBP1-88943-img0004.jpg "Simple Western: MIS18A Antibody [NBP1-88943]")
Simple Western: MIS18A Antibody [NBP1-88943]
Simple Western: MIS18A Antibody [NBP1-88943] - Simple Western lane view shows a specific band for MIS18A in 0.2 mg/ml of Ntera-2 (left) and h. Testis (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.![Simple Western: MIS18A Antibody [NBP1-88943]](https://resources.rndsystems.com/images/products/MIS18A-Antibody-Simple-Western-NBP1-88943-img0005.jpg "Simple Western: MIS18A Antibody [NBP1-88943]")
Simple Western: MIS18A Antibody [NBP1-88943]
Simple Western: MIS18A Antibody [NBP1-88943] - Electropherogram image of the corresponding Simple Western lane view. MIS18A antibody was used at 1:25 dilution on Ntera-2 and h. Testis lysate(s) respectively.Applications for MIS18A Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Ntera-2 and h. Testis lysates, separated by Size, antibody dilution of 1:25, apparent MW was 32 kDa.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Ntera-2 and h. Testis lysates, separated by Size, antibody dilution of 1:25, apparent MW was 32 kDa.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MIS18A
Alternate Names
B28, C21orf45, C21orf46, FAPP1-associated protein 1, FASP1, hMis18alpha, MIS18 kinetochore protein homolog A (S. pombe), MIS18alpha, protein Mis18-alpha
Gene Symbol
MIS18A
Additional MIS18A Products
Product Documents for MIS18A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MIS18A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for MIS18A Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MIS18A Antibody - BSA Free and earn rewards!
Have you used MIS18A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...