MISP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14390

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: SQASGITGSYSVSESPFFSPIHLHSNVAWTVEDPVDSAPPGQRKKEQWYAGINPSDGINSEVLEAIRVTRHKNAMAERWESRIYASEEDD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MISP1 Antibody - BSA Free

Western Blot: MISP1 Antibody [NBP2-14390]

Western Blot: MISP1 Antibody [NBP2-14390]

Western Blot: MISP1 Antibody [NBP2-14390] - Analysis in control (vector only transfected HEK293T lysate) and MISP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MISP1 Antibody [NBP2-14390]

Immunocytochemistry/ Immunofluorescence: MISP1 Antibody [NBP2-14390]

Immunocytochemistry/Immunofluorescence: MISP1 Antibody [NBP2-14390] - Staining of human cell line U-2 OS shows localization to plasma membrane and focal adhesion sites.
Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining in human small intestine and liver tissues using anti-MISP antibody. Corresponding MISP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human kidney.
Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Analysis in human small intestine and liver tissues. Corresponding MISP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human kidney, liver, small intestine and testis using Anti-MISP1 antibody NBP2-14390 (A) shows similar protein distribution across tissues to independent antibody NBP2-38955 (B).
Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390]

Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human kidney shows moderate positivity in luminal membrane in cells in tubules.

Applications for MISP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MISP1

Alternate Names

chromosome 19 open reading frame 21, DKFZp686H18209, hypothetical protein LOC126353

Gene Symbol

MISP

Additional MISP1 Products

Product Documents for MISP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MISP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MISP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MISP1 Antibody - BSA Free and earn rewards!

Have you used MISP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...