Mitofilin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38285

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Mitofilin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Mitofilin Antibody - BSA Free

Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38285]

Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38285]

Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38285] - Staining in human parathyroid gland and pancreas tissues using anti-IMMT antibody. Corresponding IMMT RNA-seq data are presented for the same tissues.
Western Blot: Mitofilin Antibody [NBP2-38285]

Western Blot: Mitofilin Antibody [NBP2-38285]

Western Blot: Mitofilin Antibody [NBP2-38285] - Analysis using Anti-IMMT antibody NBP2-38285 (A) shows similar pattern to independent antibody NBP2-38286 (B).
Immunocytochemistry/ Immunofluorescence: Mitofilin Antibody [NBP2-38285]

Immunocytochemistry/ Immunofluorescence: Mitofilin Antibody [NBP2-38285]

Immunocytochemistry/Immunofluorescence: Mitofilin Antibody [NBP2-38285] - Immunofluorescent staining of human cell line HEK 293 shows localization to mitochondria.
Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38285]

Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38285]

Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38285] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38285]

Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38285]

Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38285] - Staining of human parathyroid gland shows high expression.

Applications for Mitofilin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Mitofilin

Mitochondria are the center of cellular energy production and essential metabolic reactions. As double membrane-bound organelles, mitochondria from different species, tissues, and metabolic states are highly polymorphic in nature, yet exhibit common structural features. The ultrastructural variations in mitochondrial architecture occur mainly due to the differences in the amount and shape of cristae. Abundant cristae are found in mitochondria from tissues where energy demand is high. Analysis of the human heart mitochondrial proteome shows that mitofilin is one of the most abundant mitochondrial proteins. It appears to play an important role in the maintenance of cristae morphology. Mitofilin was originally described as heart muscle protein (HMP) because of its high expression in the heart.

Alternate Names

DKFZp779P1653, inner membrane protein, mitochondrial, MGC111146, Mic 60, Mic60, MICOS Complex Subunit MIC60, mitochondrial (mitofilin), Mitofilin, motor protein, p87/89, proliferation-inducing gene 4

Gene Symbol

IMMT

UniProt

Q16891 (Human)

Additional Mitofilin Products

Product Documents for Mitofilin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Mitofilin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Mitofilin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mitofilin Antibody - BSA Free and earn rewards!

Have you used Mitofilin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies