MLC1SA Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-92124
![Western Blot: MLC1SA Antibody [NBP1-92124]](https://resources.rndsystems.com/images/products/MLC1SA-Antibody-Western-Blot-NBP1-92124-img0010.jpg "Western Blot: MLC1SA Antibody [NBP1-92124]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKE
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MLC1SA Antibody - BSA Free
Western Blot: MLC1SA Antibody [NBP1-92124]
Western Blot: MLC1SA Antibody [NBP1-92124] - Analysis in control (vector only transfected HEK293T lysate) and MYL6B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).![Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]](https://resources.rndsystems.com/images/products/MLC1SA-Antibody-Immunohistochemistry-Paraffin-NBP1-92124-img0009.jpg "Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]")
![Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]](https://resources.rndsystems.com/images/products/MLC1SA-Antibody-Immunohistochemistry-Paraffin-NBP1-92124-img0002.jpg "Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]")
Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]
Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.![Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]](https://resources.rndsystems.com/images/products/MLC1SA-Antibody-Immunohistochemistry-Paraffin-NBP1-92124-img0007.jpg "Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]")
Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]
Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124] - Staining of human duodenum shows low expression as expected.![Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]](https://resources.rndsystems.com/images/products/MLC1SA-Antibody-Immunohistochemistry-Paraffin-NBP1-92124-img0008.jpg "Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]")
Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124]
Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124] - Staining of human skeletal muscle shows high expression.![MLC1SA Antibody - BSA Free Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]](https://resources.rndsystems.com/images/products/nbp1-92124_rabbit-polyclonal-mlc1sa-antibody-29520251631532.jpg "Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]")
Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]
Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.![MLC1SA Antibody - BSA Free Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]](https://resources.rndsystems.com/images/products/nbp1-92124_rabbit-polyclonal-mlc1sa-antibody-29520251627252.jpg "Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]")
![MLC1SA Antibody - BSA Free Western Blot: MLC1SA Antibody - BSA Free [NBP1-92124]](https://resources.rndsystems.com/images/products/nbp1-92124_rabbit-polyclonal-mlc1sa-antibody-29520251646022.jpg "Western Blot: MLC1SA Antibody - BSA Free [NBP1-92124]")
Western Blot: MLC1SA Antibody - BSA Free [NBP1-92124]
Analysis in human cell line SH-SY5Y.![MLC1SA Antibody - BSA Free Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]](https://resources.rndsystems.com/images/products/nbp1-92124_rabbit-polyclonal-mlc1sa-antibody-29520251624279.jpg "Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]")
Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]
Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.![MLC1SA Antibody - BSA Free Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]](https://resources.rndsystems.com/images/products/nbp1-92124_rabbit-polyclonal-mlc1sa-antibody-29520251646486.jpg "Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]")
Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]
Staining of human liver shows no positivity in hepatocytes as expected.![MLC1SA Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: MLC1SA Antibody - BSA Free [NBP1-92124]](https://resources.rndsystems.com/images/products/nbp1-92124_rabbit-polyclonal-mlc1sa-antibody-295202516445711.jpg "Immunocytochemistry/ Immunofluorescence: MLC1SA Antibody - BSA Free [NBP1-92124]")
Immunocytochemistry/ Immunofluorescence: MLC1SA Antibody - BSA Free [NBP1-92124]
Staining of human cell line A-431 shows localization to vesicles.![MLC1SA Antibody - BSA Free Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]](https://resources.rndsystems.com/images/products/nbp1-92124_rabbit-polyclonal-mlc1sa-antibody-29520251683321.jpg "Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]")
Immunohistochemistry: MLC1SA Antibody - BSA Free [NBP1-92124]
Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.Applications for MLC1SA Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20-1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MLC1SA
Alternate Names
MLC1sa, MLC1SAmyosin light chain 1, slow-twitch muscle A isoform, myosin alkali light chain 1 slow a, myosin light chain 1 slow a, Myosin light chain 1 slow-twitch muscle A isoform, myosin light chain 6B, myosin, light chain 6B, alkali, smooth muscle and non-muscle, myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle, smooth muscle and non-muscle myosin alkali light chain 6B, Smooth muscle and nonmuscle myosin light chain alkali 6B
Gene Symbol
MYL6B
Additional MLC1SA Products
Product Documents for MLC1SA Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MLC1SA Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for MLC1SA Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MLC1SA Antibody - BSA Free and earn rewards!
Have you used MLC1SA Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...