MLLT11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14237

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFEL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MLLT11 Antibody - BSA Free

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neurons.
Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237]

Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
MLLT11 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: MLLT11 Antibody [NBP2-14237]

Immunocytochemistry/ Immunofluorescence: MLLT11 Antibody [NBP2-14237]

Staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.

Applications for MLLT11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MLLT11

The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested.

Alternate Names

AF1QRP11-316M1.10, ALL1 fused gene from chromosome 1q, ALL1-fused gene from chromosome 1q, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 11, protein AF1q

Gene Symbol

MLLT11

Additional MLLT11 Products

Product Documents for MLLT11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MLLT11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MLLT11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MLLT11 Antibody - BSA Free and earn rewards!

Have you used MLLT11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...