MMP-14/MT1-MMP Antibody (6T7L3)

Novus Biologicals | Catalog # NBP3-15247

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot, ELISA, Flow Cytometry

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6T7L3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP-14/MT1-MMP (P50281). GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MMP-14/MT1-MMP Antibody (6T7L3)

Western Blot: MMP-14/MT1-MMP Antibody (6T7L3) [NBP3-15247]

Western Blot: MMP-14/MT1-MMP Antibody (6T7L3) [NBP3-15247]

Western Blot: MMP-14/MT1-MMP Antibody (6T7L3) [NBP3-15247] - Western blot analysis of extracts of various cell lines, using MMP14/MMP-14/MT1-MMP Rabbit mAb (NBP3-15247) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Western Blot: MMP-14/MT1-MMP Antibody (6T7L3) [NBP3-15247]

Western Blot: MMP-14/MT1-MMP Antibody (6T7L3) [NBP3-15247]

Western Blot: MMP-14/MT1-MMP Antibody (6T7L3) [NBP3-15247] - Western blot analysis of extracts of various cell lines, using MMP14/MMP-14/MT1-MMP Rabbit mAb (NBP3-15247) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
MMP-14/MT1-MMP Antibody (6T7L3)

Immunohistochemistry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] -

Immunohistochemistry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using MMP-14/MT1-MMP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MMP-14/MT1-MMP Antibody (6T7L3)

Immunohistochemistry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] -

Immunohistochemistry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using MMP-14/MT1-MMP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MMP-14/MT1-MMP Antibody (6T7L3)

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] -

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Flow cytometry: 1X10^6 MCF7 cells (negative control,left) and HT-1080 cells were intracellularly-stained with MMP-14/MT1-MMP Rabbit mAb or ABflo 488 Rabbit IgG isotype control, followed by Alexa Fluor 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control.
MMP-14/MT1-MMP Antibody (6T7L3)

Immunohistochemistry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] -

Immunohistochemistry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using MMP-14/MT1-MMP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MMP-14/MT1-MMP Antibody (6T7L3)

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] -

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Flow cytometry: 1X10^6 MCF7 cells (negative control,left) and HT-1080 cells were intracellularly-stained with MMP-14/MT1-MMP Rabbit mAb or ABflo 647 Rabbit IgG isotype control, followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control.
MMP-14/MT1-MMP Antibody (6T7L3)

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] -

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Flow cytometry: 1X10^6 MCF7 cells (negative control,left) and HT-1080 cells were intracellularly-stained with MMP-14/MT1-MMP Rabbit mAb or ABflo 647 Rabbit IgG isotype control, followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control.
MMP-14/MT1-MMP Antibody (6T7L3)

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] -

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Flow cytometry: 1X10^6 MCF7 cells (negative control,left) and HT-1080 cells were intracellularly-stained with MMP-14/MT1-MMP Rabbit mAb or ABflo 488 Rabbit IgG isotype control, followed by Alexa Fluor 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control.

Applications for MMP-14/MT1-MMP Antibody (6T7L3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Flow Cytometry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MMP-14/MT1-MMP

The matrix metalloproteinase (MMP) family (approximately 25 members in mammals) has been implicated in extracellular matrix remodeling associated with embryonic development, cancer formation and progression, and various other physiological and pathological events. MMP-14 is a membrane-bound matrix metalloproteinase (MT-MMP) capable of mediating pericellular proteolysis of extracellular matrix components. MMP-14 is therefore thought to be an important molecular tool for cellular remodeling of the surrounding matrix (1). Gelatinase A (type-IV collagenase; M(r) 72,000) is produced by tumour stroma cells and is believed to be crucial for their invasion and metastasis, acting by degrading extracellular matrix macro-molecules such as type IV collagen. MMP-14 may thus trigger invasion by tumor cells by activating pro-gelatinase A on the tumor cell surface (2). Observations identify MT1-MMP as a tumor-derived growth factor that regulates proliferation by controlling cell geometry within the confines of the 3D extracellular matrix (ECM) (3).

Long Name

Matrix Metalloproteinase 14/Membrane Type 1 MMP

Alternate Names

MMP-X1, MMP14, MT-MMP1, MT1-MMP

Gene Symbol

MMP14

Additional MMP-14/MT1-MMP Products

Product Documents for MMP-14/MT1-MMP Antibody (6T7L3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMP-14/MT1-MMP Antibody (6T7L3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MMP-14/MT1-MMP Antibody (6T7L3)

There are currently no reviews for this product. Be the first to review MMP-14/MT1-MMP Antibody (6T7L3) and earn rewards!

Have you used MMP-14/MT1-MMP Antibody (6T7L3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...