MPP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17059

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MPP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MPP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MPP1 Antibody [NBP3-17059]

Immunocytochemistry/ Immunofluorescence: MPP1 Antibody [NBP3-17059]

Immunocytochemistry/Immunofluorescence: MPP1 Antibody [NBP3-17059] - Staining of human cell line HEL shows localization to plasma membrane.
Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059]

Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059]

Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059] - Staining of human retina shows strong cytoplasmic positivity in photoreceptor cells and outer plexiform layer.
Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059]

Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059]

Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059] - Analysis in human placenta and skin tissues using Anti-MPP1 antibody. Corresponding MPP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059]

Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059]

Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059]

Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059]

Immunohistochemistry-Paraffin: MPP1 Antibody [NBP3-17059] - Staining of human skin shows low expression as expected.

Applications for MPP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MPP1

Palmitoylated membrane protein 1 is the prototype of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. Palmitoylated membrane protein 1 contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction.

Alternate Names

55 kDa erythrocyte membrane protein, AAG12, EC 2.7.11, Membrane protein, palmitoylated 1, membrane protein, palmitoylated 1, 55kDa, MRG1, palmitoylated erythrocyte membrane protein, PEMPpalmitoylated 1 (55kD)

Gene Symbol

MPP1

Additional MPP1 Products

Product Documents for MPP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MPP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MPP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MPP1 Antibody - BSA Free and earn rewards!

Have you used MPP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies