MPST Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82617
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Mouse, Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
Reactivity Notes
Reactivity reported in scientific literature (PMID: 23215842). Mouse reactivity reported in scientific literature (PMID: 27521839). Use in Rat reported in scientific literature (PMID:32215177).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for MPST Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: MPST Antibody [NBP1-82617]
Immunocytochemistry/Immunofluorescence: MPST Antibody [NBP1-82617] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617]
Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617]
Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.Simple Western: MPST Antibody [NBP1-82617]
Simple Western: MPST Antibody [NBP1-82617] - Simple Western lane view shows a specific band for MPST in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: MPST Antibody [NBP1-82617]
Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on Liver lysate(s).Simple Western: MPST Antibody [NBP1-82617]
Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on RT-4 lysate(s).Immunohistochemistry: MPST Antibody - BSA Free [NBP1-82617] -
3-MST deficiency exacerbates joint calcification and cartilage damage in experimental OA. a Representative immunohistochemical analysis of 3-MST expression in the knee section from sham-operated and MNX WT mice. A knee section from a sham-operated 3-Mst KO mouse was used to prove the specificity of the 3-MST antibody. Scale bars 150 μm. b Representative micro-CT scan images of WT and 3-MST KO MNX murine knee joints two months after surgery. White arrows show calcified periarticular deposits in MNX WT knees and their exacerbation in 3-MST KO mice. Graphs show CTAnalyzer quantitative analysis of new formation volume (mm3) and new formation crystal content (μg) in WT and 3-MST KO MNX knees. c Representative histologies of WT and 3-MST KO MNX knees, stained with Safranin-O. Black arrows show increased cartilage degradation in 3-MST KO mice. Scale bars 150 μm. Graphs show femoral scoring of cartilage damage and Safranin-O loss, accordingly to OARSI method. d Thiosulfate measurement in the serum of WT and 3-MST KO mice. Mice number WT n = 8, 3-MST KO n = 8 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32183900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: MPST Antibody - BSA Free [NBP1-82617] -
Cartilage 3-MST expression is negatively correlated with OA severity and chondrocyte calcification and downmodulated by HA crystals. a 3-MST immunohistochemical staining in cartilage explants from end-stage osteoarthritis patients and consecutive sections stained with von Kossa/Safranin-O staining for calcium-containing crystals. For each staining, one representative picture from one out of 14 patients is shown. Scale bars 200 μm. The graph shows the correlation between the % of 3-MST-positive cells and the % of calcified cartilage in the different patients. n = 14 patients. b Immunohistochemical staining of 3-MST in cartilage from individuals with low, medium, and high stage osteoarthritis and von Kossa/Safranin-O staining for calcium-containing crystals in consecutive sections. Pictures from one representative patient out of 5 patients per group are shown. Scale bars 200 μm. The graphs show the % of 3-MST-positive cells and the % of calcified cartilage. Three fields were counted per patient and the mean plotted in the graph. n = 14 patients. c 3-MST immunohistochemistry of human cartilage explants stimulated 24 h with HA crystals (HA 500 μg/ml) or not (Nt). Scale bars 200 μm. The graph shows the % of 3-MST-positive cells in Nt vs HA-treated explants in each patient. Lines connect the Nt condition and the HA condition for each patient. n = 4 patients Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32183900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: MPST Antibody - BSA Free [NBP1-82617] -
Cartilage 3-MST expression is negatively correlated with OA severity and chondrocyte calcification and downmodulated by HA crystals. a 3-MST immunohistochemical staining in cartilage explants from end-stage osteoarthritis patients and consecutive sections stained with von Kossa/Safranin-O staining for calcium-containing crystals. For each staining, one representative picture from one out of 14 patients is shown. Scale bars 200 μm. The graph shows the correlation between the % of 3-MST-positive cells and the % of calcified cartilage in the different patients. n = 14 patients. b Immunohistochemical staining of 3-MST in cartilage from individuals with low, medium, and high stage osteoarthritis and von Kossa/Safranin-O staining for calcium-containing crystals in consecutive sections. Pictures from one representative patient out of 5 patients per group are shown. Scale bars 200 μm. The graphs show the % of 3-MST-positive cells and the % of calcified cartilage. Three fields were counted per patient and the mean plotted in the graph. n = 14 patients. c 3-MST immunohistochemistry of human cartilage explants stimulated 24 h with HA crystals (HA 500 μg/ml) or not (Nt). Scale bars 200 μm. The graph shows the % of 3-MST-positive cells in Nt vs HA-treated explants in each patient. Lines connect the Nt condition and the HA condition for each patient. n = 4 patients Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32183900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for MPST Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in Liver, separated by Size, antibody dilution of 1:20, apparent MW was 39 kDa
See Simple Western Antibody Database for Simple Western validation: Tested in Liver, separated by Size, antibody dilution of 1:20, apparent MW was 39 kDa
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MPST
Alternate Names
mercaptopyruvate sulfurtransferase, MGC24539, MSThuman liver rhodanese, TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase
Entrez Gene IDs
4357 (Human)
Gene Symbol
MPST
UniProt
Additional MPST Products
Product Documents for MPST Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MPST Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for MPST Antibody - BSA Free
Customer Reviews for MPST Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MPST Antibody - BSA Free and earn rewards!
Have you used MPST Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...