MPST Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82617

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23215842). Mouse reactivity reported in scientific literature (PMID: 27521839). Use in Rat reported in scientific literature (PMID:32215177).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MPST Antibody - BSA Free

Western Blot: MPST Antibody [NBP1-82617]

Western Blot: MPST Antibody [NBP1-82617]

Western Blot: MPST Antibody [NBP1-82617] - Analysis in human cell lines HEK293 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunocytochemistry/ Immunofluorescence: MPST Antibody [NBP1-82617]

Immunocytochemistry/ Immunofluorescence: MPST Antibody [NBP1-82617]

Immunocytochemistry/Immunofluorescence: MPST Antibody [NBP1-82617] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617]

Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617]

Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617]

Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617]

Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Simple Western: MPST Antibody [NBP1-82617]

Simple Western: MPST Antibody [NBP1-82617]

Simple Western: MPST Antibody [NBP1-82617] - Simple Western lane view shows a specific band for MPST in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: MPST Antibody [NBP1-82617]

Simple Western: MPST Antibody [NBP1-82617]

Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on Liver lysate(s).
Simple Western: MPST Antibody [NBP1-82617]

Simple Western: MPST Antibody [NBP1-82617]

Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on RT-4 lysate(s).
MPST Antibody - BSA Free

Immunohistochemistry: MPST Antibody - BSA Free [NBP1-82617] -

3-MST deficiency exacerbates joint calcification and cartilage damage in experimental OA. a Representative immunohistochemical analysis of 3-MST expression in the knee section from sham-operated and MNX WT mice. A knee section from a sham-operated 3-Mst KO mouse was used to prove the specificity of the 3-MST antibody. Scale bars 150 μm. b Representative micro-CT scan images of WT and 3-MST KO MNX murine knee joints two months after surgery. White arrows show calcified periarticular deposits in MNX WT knees and their exacerbation in 3-MST KO mice. Graphs show CTAnalyzer quantitative analysis of new formation volume (mm3) and new formation crystal content (μg) in WT and 3-MST KO MNX knees. c Representative histologies of WT and 3-MST KO MNX knees, stained with Safranin-O. Black arrows show increased cartilage degradation in 3-MST KO mice. Scale bars 150 μm. Graphs show femoral scoring of cartilage damage and Safranin-O loss, accordingly to OARSI method. d Thiosulfate measurement in the serum of WT and 3-MST KO mice. Mice number WT n = 8, 3-MST KO n = 8 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32183900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MPST Antibody - BSA Free

Immunohistochemistry: MPST Antibody - BSA Free [NBP1-82617] -

Cartilage 3-MST expression is negatively correlated with OA severity and chondrocyte calcification and downmodulated by HA crystals. a 3-MST immunohistochemical staining in cartilage explants from end-stage osteoarthritis patients and consecutive sections stained with von Kossa/Safranin-O staining for calcium-containing crystals. For each staining, one representative picture from one out of 14 patients is shown. Scale bars 200 μm. The graph shows the correlation between the % of 3-MST-positive cells and the % of calcified cartilage in the different patients. n = 14 patients. b Immunohistochemical staining of 3-MST in cartilage from individuals with low, medium, and high stage osteoarthritis and von Kossa/Safranin-O staining for calcium-containing crystals in consecutive sections. Pictures from one representative patient out of 5 patients per group are shown. Scale bars 200 μm. The graphs show the % of 3-MST-positive cells and the % of calcified cartilage. Three fields were counted per patient and the mean plotted in the graph. n = 14 patients. c 3-MST immunohistochemistry of human cartilage explants stimulated 24 h with HA crystals (HA 500 μg/ml) or not (Nt). Scale bars 200 μm. The graph shows the % of 3-MST-positive cells in Nt vs HA-treated explants in each patient. Lines connect the Nt condition and the HA condition for each patient. n = 4 patients Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32183900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MPST Antibody - BSA Free

Immunohistochemistry: MPST Antibody - BSA Free [NBP1-82617] -

Cartilage 3-MST expression is negatively correlated with OA severity and chondrocyte calcification and downmodulated by HA crystals. a 3-MST immunohistochemical staining in cartilage explants from end-stage osteoarthritis patients and consecutive sections stained with von Kossa/Safranin-O staining for calcium-containing crystals. For each staining, one representative picture from one out of 14 patients is shown. Scale bars 200 μm. The graph shows the correlation between the % of 3-MST-positive cells and the % of calcified cartilage in the different patients. n = 14 patients. b Immunohistochemical staining of 3-MST in cartilage from individuals with low, medium, and high stage osteoarthritis and von Kossa/Safranin-O staining for calcium-containing crystals in consecutive sections. Pictures from one representative patient out of 5 patients per group are shown. Scale bars 200 μm. The graphs show the % of 3-MST-positive cells and the % of calcified cartilage. Three fields were counted per patient and the mean plotted in the graph. n = 14 patients. c 3-MST immunohistochemistry of human cartilage explants stimulated 24 h with HA crystals (HA 500 μg/ml) or not (Nt). Scale bars 200 μm. The graph shows the % of 3-MST-positive cells in Nt vs HA-treated explants in each patient. Lines connect the Nt condition and the HA condition for each patient. n = 4 patients Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32183900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for MPST Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes

ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in Liver, separated by Size, antibody dilution of 1:20, apparent MW was 39 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MPST

MPST encodes a protein which can function as a monomer or as a disulfide-linked homodimer and which catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cyanide degradation and in thiosulfate biosynthesis. The encoded cytoplasmic protein is a member of the rhodanese family but is not rhodanese itself, which is a mitochondrial protein. Alternatively spliced transcript variants encoding the same protein have been identified.

Alternate Names

mercaptopyruvate sulfurtransferase, MGC24539, MSThuman liver rhodanese, TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase

Entrez Gene IDs

4357 (Human)

Gene Symbol

MPST

UniProt

Additional MPST Products

Product Documents for MPST Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MPST Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MPST Antibody - BSA Free

Customer Reviews for MPST Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MPST Antibody - BSA Free and earn rewards!

Have you used MPST Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...