MRGPRF Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83341

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAGNCSWEAHPGNRNRMCPGLSEAPELYSRGFLTIEQIAMLP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRGPRF Antibody - BSA Free

Western Blot: MRGPRF Antibody [NBP1-83341]

Western Blot: MRGPRF Antibody [NBP1-83341]

Western Blot: MRGPRF Antibody [NBP1-83341] - Analysis in control (vector only transfected HEK293T lysate) and MRGPRF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MRGPRF Antibody [NBP1-83341]

Immunocytochemistry/ Immunofluorescence: MRGPRF Antibody [NBP1-83341]

Immunocytochemistry/Immunofluorescence: MRGPRF Antibody [NBP1-83341] - Staining of human cell line BJ shows localization to nuclear membrane & plasma membrane. Antibody staining shown in green.
Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341] - Analysis in human prostate and skeletal muscle tissues. Corresponding MRGPRF RNA-seq data are presented for the same tissues.
Immunohistochemistry: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry: MRGPRF Antibody [NBP1-83341] - Staining of human endometrium shows weak to moderate membranous positivity in stromal cells.
Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341]

Immunohistochemistry-Paraffin: MRGPRF Antibody [NBP1-83341] - Staining of human prostate shows moderate membranous positivity in smooth muscle cells.

Applications for MRGPRF Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRGPRF

MRGF is an orphan receptor that may bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain.

Long Name

Mas-related G Protein-coupled Receptor Member F

Alternate Names

GPR140, GPR168, RTA

Gene Symbol

MRGPRF

Additional MRGPRF Products

Product Documents for MRGPRF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRGPRF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRGPRF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRGPRF Antibody - BSA Free and earn rewards!

Have you used MRGPRF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...