MTMR9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35315

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MTMR9 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human MTMR9 (NP_056273.2).

Sequence:
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDKRFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLNVAQQTRAKGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MTMR9 Antibody - BSA Free

MTMR9 Antibody

Immunocytochemistry/ Immunofluorescence: MTMR9 Antibody [NBP3-35315] -

Immunocytochemistry/ Immunofluorescence: MTMR9 Antibody [NBP3-35315] - Immunofluorescence analysis of HeLa cells using MTMR9 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
MTMR9 Antibody

Immunocytochemistry/ Immunofluorescence: MTMR9 Antibody [NBP3-35315] -

Immunocytochemistry/ Immunofluorescence: MTMR9 Antibody [NBP3-35315] - Immunofluorescence analysis of L929 cells using MTMR9 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
MTMR9 Antibody

Western Blot: MTMR9 Antibody [NBP3-35315] -

Western Blot: MTMR9 Antibody [NBP3-35315] - Western blot analysis of various lysates, using MTMR9 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
MTMR9 Antibody

Immunohistochemistry: MTMR9 Antibody [NBP3-35315] -

Immunohistochemistry: MTMR9 Antibody [NBP3-35315] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using MTMR9 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for MTMR9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MTMR9

MTMR9 encodes a myotubularin-related protein that is atypical to most other members of the myotubularin-related protein family because it has no dual-specificity phosphatase domain. The encoded protein contains a double-helical motif similar to the SET interaction domain, which is thought to have a role in the control of cell proliferation. In mouse, a protein similar to the encoded protein binds with MTMR7, and together they dephosphorylate phosphatidylinositol 3-phosphate and inositol 1,3-bisphosphate.

Alternate Names

DKFZp434K171, LIP-STYX, MGC126672, MTMR8C8orf9, myotubularin related protein 8, myotubularin related protein 9, myotubularin-related protein 9

Gene Symbol

MTMR9

Additional MTMR9 Products

Product Documents for MTMR9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MTMR9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MTMR9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTMR9 Antibody - BSA Free and earn rewards!

Have you used MTMR9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies