Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94150

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHRM5 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 275-370 of human Muscarinic Acetylcholine Receptor M5/CHRM5 (NP_036257.1). RRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free

Western Blot: Muscarinic Acetylcholine Receptor M5/CHRM5 AntibodyAzide and BSA Free [NBP2-94150]

Western Blot: Muscarinic Acetylcholine Receptor M5/CHRM5 AntibodyAzide and BSA Free [NBP2-94150]

Western Blot: Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody [NBP2-94150] - Western blot analysis of extracts of Mouse spinal cord, using Muscarinic Acetylcholine Receptor M5/CHRM5 antibody (NBP2-94150) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CHRM5

Muscarinic cholinergic receptor M5 is an Acetylcholine Receptor that is active during embryonic development. It is coupled to phosphoinositide degradation and to the activation of mitogen-activated protein kinase (MAPK). The M5 receptor has been reported to be expressed in blood, brain, and ovary. ESTs have been isolated from human testis and placenta libraries.

Long Name

Cholinergic Receptor Muscarinic 5

Alternate Names

HM5, M5, M5R, mAChR M5

Gene Symbol

CHRM5

Additional CHRM5 Products

Product Documents for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free and earn rewards!

Have you used Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies