Muscleblind-like 1 Antibody (7N6W3)

Novus Biologicals | Catalog # NBP3-16574

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7N6W3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 289-388 of human Muscleblind-like 1 (Q9NR56). IPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Muscleblind-like 1 Antibody (7N6W3)

Western Blot: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574]

Western Blot: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574]

Western Blot: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574] - Western blot analysis of extracts of various cell lines, using Muscleblind-like 1 Rabbit mAb (NBP3-16574) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574]

Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574]

Immunocytochemistry/Immunofluorescence: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574] - Immunofluorescence analysis of U-2 OS cells using Muscleblind-like 1 Rabbit mAb (NBP3-16574) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Muscleblind-like 1 Antibody (7N6W3)

Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574] -

Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody (7N6W3) [NBP3-16574] - Confocal imaging of U-2 OS cells using Muscleblind-like 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Muscleblind-like 1 Antibody (7N6W3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Muscleblind-like 1

Several important human diseases are associated with expansion of polynucleotide sequences, in most cases trinucleotide repeats. Myotonic dystrophy (DM1) is one of these diseases, and is associated with increases in the number of CTG repeats in the UTR of the gene encoding myotonin (a.k.a. DM Kinase, DMK or myotonin-Protein Kinase), a ser/thr kinase expressed specifically in muscle. Mammalian genomes contain three muscleblind-like proteins, generally referred to as MBNL1, MBNL2 and MBNL3, and all three were found to associate with long double stranded CUG RNA repeats, thus, being triplet repeat expansion dsRNA-binding proteins.

Alternate Names

DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein

Gene Symbol

MBNL1

Additional Muscleblind-like 1 Products

Product Documents for Muscleblind-like 1 Antibody (7N6W3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Muscleblind-like 1 Antibody (7N6W3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Muscleblind-like 1 Antibody (7N6W3)

There are currently no reviews for this product. Be the first to review Muscleblind-like 1 Antibody (7N6W3) and earn rewards!

Have you used Muscleblind-like 1 Antibody (7N6W3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...