Muscleblind-like 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80488

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Muscleblind-like 1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human MBNL1 (AAH50535). Peptide sequence AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Muscleblind-like 1 Antibody - BSA Free

Western Blot: Muscleblind-like 1 Antibody [NBP1-80488]

Western Blot: Muscleblind-like 1 Antibody [NBP1-80488]

Western Blot: Muscleblind-like 1 Antibody [NBP1-80488] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: Muscleblind-like 1 Antibody [NBP1-80488]

Immunohistochemistry: Muscleblind-like 1 Antibody [NBP1-80488]

Immunohistochemistry: Muscleblind-like 1 Antibody [NBP1-80488] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP1-80488]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP1-80488]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP1-80488] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.

Applications for Muscleblind-like 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Muscleblind-like 1

Several important human diseases are associated with expansion of polynucleotide sequences, in most cases trinucleotide repeats. Myotonic dystrophy (DM1) is one of these diseases, and is associated with increases in the number of CTG repeats in the UTR of the gene encoding myotonin (a.k.a. DM Kinase, DMK or myotonin-Protein Kinase), a ser/thr kinase expressed specifically in muscle. Mammalian genomes contain three muscleblind-like proteins, generally referred to as MBNL1, MBNL2 and MBNL3, and all three were found to associate with long double stranded CUG RNA repeats, thus, being triplet repeat expansion dsRNA-binding proteins.

Alternate Names

DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein

Entrez Gene IDs

4154 (Human)

Gene Symbol

MBNL1

UniProt

Q9NR56 (Human)

Additional Muscleblind-like 1 Products

Product Documents for Muscleblind-like 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Muscleblind-like 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Muscleblind-like 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Muscleblind-like 1 Antibody - BSA Free and earn rewards!

Have you used Muscleblind-like 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies