Muscleblind-like 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80489

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human MBNL1. Peptide sequence LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Muscleblind-like 1 Antibody - BSA Free

Western Blot: Muscleblind-like 1 Antibody [NBP1-80489]

Western Blot: Muscleblind-like 1 Antibody [NBP1-80489]

Western Blot: Muscleblind-like 1 Antibody [NBP1-80489] - Titration: 2.5ug/ml, Positive Control: Jurkat cell lysate.
Immunohistochemistry: Muscleblind-like 1 Antibody [NBP1-80489]

Immunohistochemistry: Muscleblind-like 1 Antibody [NBP1-80489]

Immunohistochemistry: Muscleblind-like 1 Antibody [NBP1-80489] - Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic, nucleus Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for Muscleblind-like 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Muscleblind-like 1

Several important human diseases are associated with expansion of polynucleotide sequences, in most cases trinucleotide repeats. Myotonic dystrophy (DM1) is one of these diseases, and is associated with increases in the number of CTG repeats in the UTR of the gene encoding myotonin (a.k.a. DM Kinase, DMK or myotonin-Protein Kinase), a ser/thr kinase expressed specifically in muscle. Mammalian genomes contain three muscleblind-like proteins, generally referred to as MBNL1, MBNL2 and MBNL3, and all three were found to associate with long double stranded CUG RNA repeats, thus, being triplet repeat expansion dsRNA-binding proteins.

Alternate Names

DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein

Gene Symbol

MBNL1

Additional Muscleblind-like 1 Products

Product Documents for Muscleblind-like 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Muscleblind-like 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Muscleblind-like 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Muscleblind-like 1 Antibody - BSA Free and earn rewards!

Have you used Muscleblind-like 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...