MxA/Mx1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83120

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Cited:

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MxA/Mx1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25878567).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit MxA/Mx1 Antibody - BSA Free (NBP1-83120) is a polyclonal antibody validated for use in IHC, WB and ELISA. Anti-MxA/Mx1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for MxA/Mx1 Antibody - BSA Free

Western Blot: MxA/Mx1 Antibody [NBP1-83120]

Western Blot: MxA/Mx1 Antibody [NBP1-83120]

Western Blot: MxA/Mx1 Antibody [NBP1-83120] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-MX1 antibody. Corresponding MX1 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.
Western Blot: MxA/Mx1 Antibody [NBP1-83120]

Western Blot: MxA/Mx1 Antibody [NBP1-83120]

Western Blot: MxA/Mx1 Antibody [NBP1-83120] - Analysis in human cell line SK-MEL-30 and human cell line A-549.
Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120]

Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120]

Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120]

Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120]

Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120]

Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120]

Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120]

Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120]

Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human small intestine shows strong cytoplasmic positivity in glandular as well as lymphoid cells.

Applications for MxA/Mx1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
ELISA, WB reported in scientific literature (PMID: 25878567). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MxA/Mx1

In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. The protein encoded by this gene is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. [provided by RefSeq]

Long Name

Interferon-regulated Resistance GTP-binding protein MxA

Alternate Names

IFI-78K, IFI78, Mx1

Gene Symbol

MX1

Additional MxA/Mx1 Products

Product Documents for MxA/Mx1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MxA/Mx1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Infectious Diseases

Citations for MxA/Mx1 Antibody - BSA Free

Customer Reviews for MxA/Mx1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MxA/Mx1 Antibody - BSA Free and earn rewards!

Have you used MxA/Mx1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies