MyBPC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13632

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: TGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MyBPC3 Antibody - BSA Free

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human endometrium, heart muscle, pancreas and prostate using Anti-MyBPC3 antibody NBP2-13632 (A) shows similar protein distribution across tissues to independent antibody NBP2-13631 (B).
Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632]

Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
MyBPC3 Antibody - BSA Free Immunohistochemistry: MyBPC3 Antibody - BSA Free [NBP2-13632]

Immunohistochemistry: MyBPC3 Antibody - BSA Free [NBP2-13632]

Analysis in human heart muscle and prostate tissues using NBP2-13632 antibody. Corresponding MYBPC3 RNA-seq data are presented for the same tissues.
MyBPC3 Antibody - BSA Free Immunohistochemistry: MyBPC3 Antibody - BSA Free [NBP2-13632]

Immunohistochemistry: MyBPC3 Antibody - BSA Free [NBP2-13632]

Staining of human prostate shows no positivity in smooth muscle cells or glandular cells as expected.
MyBPC3 Antibody - BSA Free Immunohistochemistry: MyBPC3 Antibody - BSA Free [NBP2-13632]

Immunohistochemistry: MyBPC3 Antibody - BSA Free [NBP2-13632]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for MyBPC3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 -1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MyBPC3

Cardiac myosin binding protein C3 (MyBPC3) is a 140 kDa thick filament-associated protein located in the crossbridge region of cardiac muscle sarcomeres. It is composed of eight Ig-like domains and three fibronectin 3-like domains and is known to be a physiological substrate of cAMP-dependent protein kinase. MyBPC3 has a role in sarcomeric structure and in the regulation of cardiac muscle contraction. MyBPC3 is released into the coronary effluent during myocardial infarction. Mutations in MyBPC3 are associated with hypertrophic cardiomyopathy.

Long Name

Myosin Binding Protein C, Cardiac

Alternate Names

C-protein, cardiac muscle isoform, CMH4, FHC, MYBP-C

Gene Symbol

MYBPC3

Additional MyBPC3 Products

Product Documents for MyBPC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MyBPC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MyBPC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MyBPC3 Antibody - BSA Free and earn rewards!

Have you used MyBPC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...