MYD118 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58997

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MYD118 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GADD45B(growth arrest and DNA-damage-inducible, beta) The peptide sequence was selected from the middle region of GADD45B. Peptide sequence FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MYD118 Antibody - BSA Free

Western Blot: MYD118 Antibody [NBP1-58997]

Western Blot: MYD118 Antibody [NBP1-58997]

Western Blot: MYD118 Antibody [NBP1-58997] - Fetal Lung lysates, Antibody Dilution: 3.0 ug/ml.
Immunohistochemistry: MYD118 Antibody [NBP1-58997]

Immunohistochemistry: MYD118 Antibody [NBP1-58997]

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B
Western Blot: MYD118 Antibody [NBP1-58997]

Western Blot: MYD118 Antibody [NBP1-58997]

Western Blot: MYD118 Antibody [NBP1-58997] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: MYD118 Antibody [NBP1-58997]

Immunohistochemistry: MYD118 Antibody [NBP1-58997]

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B
Immunohistochemistry: MYD118 Antibody [NBP1-58997]

Immunohistochemistry: MYD118 Antibody [NBP1-58997]

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B

Applications for MYD118 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

2ug/mL

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MYD118

The function of GADD45B is involved in the regulation of growth and apoptosis.This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

DKFZp566B133, GADD45BETA, growth arrest and DNA damage-inducible protein GADD45 beta, growth arrest and DNA-damage-inducible, beta, MYD118DKFZP566B133, Myeloid differentiation primary response protein MyD118, Negative growth regulatory protein MyD118

Gene Symbol

GADD45B

UniProt

O75293 (Human)

Additional MYD118 Products

Product Documents for MYD118 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MYD118 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MYD118 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MYD118 Antibody - BSA Free and earn rewards!

Have you used MYD118 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies