MYL9 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94899

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all MYL9 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2). MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MYL9 Antibody - Azide and BSA Free

Western Blot: MYL9 AntibodyAzide and BSA Free [NBP2-94899]

Western Blot: MYL9 AntibodyAzide and BSA Free [NBP2-94899]

Western Blot: MYL9 Antibody [NBP2-94899] - Western blot analysis of extracts of various cell lines, using MYL9 antibody (NBP2-94899) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
MYL9 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MYL9 Antibody - Azide and BSA Free [MYL9] -

Immunocytochemistry/ Immunofluorescence: MYL9 Antibody - Azide and BSA Free [MYL9] - Immunofluorescence analysis of Mouse intestine using MYL9 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
MYL9 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MYL9 Antibody - Azide and BSA Free [MYL9] -

Immunocytochemistry/ Immunofluorescence: MYL9 Antibody - Azide and BSA Free [MYL9] - Immunofluorescence analysis of Rat intestine using MYL9 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
MYL9 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MYL9 Antibody - Azide and BSA Free [MYL9] -

Immunocytochemistry/ Immunofluorescence: MYL9 Antibody - Azide and BSA Free [MYL9] - Immunofluorescence analysis of Human colon carcinoma using MYL9 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for MYL9 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MYL9

Myosin is the major component of thick muscle filaments, and is a long asymmetric molecule containing a globular head and a long tail. The molecule consists of two heavy chains each ~200,000 daltons, and four light chains each ~16,000 - 21,000 daltons. Activation of smooth and cardiac muscle primarily involves pathways that increase calcium and myosin phosphorylation resulting in contraction. Myosin light chain phosphatase acts to regulate muscle contraction by dephosphorylating activated myosin light chain. The selected peptide sequence used to generate the polyclonal antibody is located near the amino terminal end of the polypeptide corresponding to the smooth/non-muscle form of myosin regulatory light chain found in cardiac myocytes in addition to smooth and non-muscle cells. This sequence differs from that of the sarcomeric/ cardiac form of myosin regulatory light chain that has a different sequence around the phosphorylation site. Human, mouse and rat have almost identical sequences.

Alternate Names

LC2020 kDa myosin light chain, MLC2Myosin RLC, MRLC1MLC-2C, myosin regulatory light chain 1, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1, myosin regulatory light polypeptide 9, myosin, light chain 9, regulatory, myosin, light polypeptide 9, regulatory, MYRL2MGC3505

Gene Symbol

MYL9

Additional MYL9 Products

Product Documents for MYL9 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MYL9 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MYL9 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MYL9 Antibody - Azide and BSA Free and earn rewards!

Have you used MYL9 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies