Myosin light chain 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88068

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEM

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Myosin light chain 3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Analysis in human heart muscle and lymph node tissues. Corresponding MYL3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068]

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Applications for Myosin light chain 3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myosin light chain 3

Myosin light chain 3, or MYL3 for short, consists of a 195 amino acid isoform that is 22 kDa, and is involved in the regulation of Myosin, which is a protein that conducts ATP hydrolysis. Current research is being conducted on the relationship between Myosin light chain 3 and a multitude of diseases and disorders, including familial hypertrophic cardiomyopathy, congestive heart failure, restrictive cardiomyopathy, dilated cardiomyopathy, diabetes mellitus, and renal failure. Myosin light chain 3 has been linked to the RhoA pathway, as well as PKA signaling, growth cone motility, cell adhesion, cardiac muscle contraction, and cytoskeleton remodeling. The protein interacts with YWHAQ, MYH13, YWHAZ, MYH9, and MYH7.

Alternate Names

Cardiac myosin light chain 1, CMH8Ventricular/slow twitch myosin alkali light chain, CMLC1, light polypeptide 3, alkali; ventricular, skeletal, slow, MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform, MLC1V, myosin light chain 3, myosin, light chain 3, alkali; ventricular, skeletal, slow, VLC1

Gene Symbol

MYL3

Additional Myosin light chain 3 Products

Product Documents for Myosin light chain 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myosin light chain 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin light chain 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myosin light chain 3 Antibody - BSA Free and earn rewards!

Have you used Myosin light chain 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...