Myozenin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34020

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESED

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Myozenin 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020] - Staining of human kidney.
Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020] - Staining in human heart muscle and prostate tissues using anti-MYOZ2 antibody. Corresponding MYOZ2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020] - Staining of human heart muscle, kidney, liver and prostate using Anti-MYOZ2 antibody NBP2-34020 (A) shows similar protein distribution across tissues to independent antibody NBP1-88259 (B).
Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020]

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP2-34020] - Staining of human liver.

Applications for Myozenin 2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myozenin 2

Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis

Alternate Names

C4orf5, calcineurin-binding protein calsarcin-1, Calsarcin-1, chromosome 4 open reading frame 5, CS-1, FATZ related protein 2, FATZ-related protein 2, muscle-specific protein, myozenin 2, myozenin-2

Gene Symbol

MYOZ2

UniProt

Additional Myozenin 2 Products

Product Documents for Myozenin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myozenin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myozenin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myozenin 2 Antibody - BSA Free and earn rewards!

Have you used Myozenin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...