Myt1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87873

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Myt1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Myt1. Peptide sequence: CTGSGHVRGKYSRHRSLQSCPLAKKRKLEGAEAEHLVSKRKSHPLKLALD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Myt1 Antibody - BSA Free

Western Blot: Myt1 Antibody [NBP2-87873]

Western Blot: Myt1 Antibody [NBP2-87873]

Western Blot: Myt1 Antibody [NBP2-87873] - WB Suggested Anti-MYT1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: THP-1 cell lysate
Immunohistochemistry-Paraffin: Myt1 Antibody [NBP2-87873]

Immunohistochemistry-Paraffin: Myt1 Antibody [NBP2-87873]

Immunohistochemistry-Paraffin: Myt1 Antibody [NBP2-87873] - Sample Type: Human Optic Nerve and Spinal CordCellular Target: Oligoden Drocyte Lineage cells. Dilution: 1:1000

Applications for Myt1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myt1

MYT1, also known as Myelin transcription factor 1, consists of a long 1,121 amino acid isoform that is 122 kDa, and is involved in the development of the central nervous system and the regulation of oligodendrocyte lineage development. Current research is being conducted on the relationship between MYT1 and a variety of diseases and disorders, including multiple sclerosis, papillary thyroid carcinoma, leukomalacia, neuronitis, sporadic breast cancer, skin cancer, pancreatitis, schizophrenia, thyroiditis, and carcinoma. The protein interacts with SIN3B, PIN1, PLK1, HDAC1, and CDK1, and has been linked to pancreatic and breast cancer pathways, as well as G1 to S cell cycle control.

Long Name

Myelin transcription factor 1

Alternate Names

KIAA0835, KIAA1050, MTF1, MyTI, PLPB1

Gene Symbol

MYT1

Additional Myt1 Products

Product Documents for Myt1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myt1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myt1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myt1 Antibody - BSA Free and earn rewards!

Have you used Myt1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies