N-Acetyl-D-Glucosamine Kinase/NAGK Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38240

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all N-Acetyl-D-Glucosamine Kinase/NAGK Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody - BSA Free

Western Blot: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Western Blot: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Western Blot: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240] - Staining of human kidney.
Immunohistochemistry: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240] - Staining of human lymph node shows strong cytoplasmic positivity in subsets of cells.
Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240] - Staining of human colon, kidney, liver and tonsil using Anti-NAGK antibody NBP2-38240 (A) shows similar protein distribution across tissues to independent antibody NBP1-89750 (B).
Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240] - Staining of human colon.
Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240] - Staining of human liver.
Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240]

Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP2-38240] - Staining of human tonsil.

Applications for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: N-Acetyl-D-Glucosamine Kinase/NAGK

N-acetylglucosamine kinase (NAGK; EC 2.7.1.59) converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. NAGK belongs to the group of N-acetylhexosamine kinases and is a prominent salvage enzyme of amino sugar metabolism in mammals.(supplied by OMIM)

Long Name

N-Acetyl-D-Glucosamine Kinase

Alternate Names

GlcNAc Kinase, GNK, N-Acetylglucosamine Kinase

Gene Symbol

NAGK

UniProt

Q9UJ70 (Human)

Additional N-Acetyl-D-Glucosamine Kinase/NAGK Products

Product Documents for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review N-Acetyl-D-Glucosamine Kinase/NAGK Antibody - BSA Free and earn rewards!

Have you used N-Acetyl-D-Glucosamine Kinase/NAGK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies