N acetyl transferase 5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-94531
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 49-178 of human NAA20 (NP_057184.1). PGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for N acetyl transferase 5 Antibody - BSA Free
Western Blot: N acetyl transferase 5 AntibodyAzide and BSA Free [NBP2-94531]
Western Blot: N acetyl transferase 5 Antibody [NBP2-94531] - Analysis of extracts of various cell lines, using N acetyl transferase 5.Exposure time: 90s.Immunohistochemistry-Paraffin: N acetyl transferase 5 Antibody - Azide and BSA Free [NBP2-94531]
Immunohistochemistry-Paraffin: N acetyl transferase 5 Antibody [NBP2-94531] - Paraffin-embedded rat kidney using N acetyl transferase 5.Western Blot: N acetyl transferase 5 AntibodyAzide and BSA Free [NBP2-94531]
Western Blot: N acetyl transferase 5 Antibody [NBP2-94531] - Analysis of 200ug extracts of MCF7 cells using N acetyl transferase 5 at a dilition of 1:1000.Immunohistochemistry-Paraffin: N acetyl transferase 5 Antibody - Azide and BSA Free [NBP2-94531]
Immunohistochemistry-Paraffin: N acetyl transferase 5 Antibody [NBP2-94531] - Paraffin-embedded human oophoroma using N acetyl transferase 5.Applications for N acetyl transferase 5 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunoprecipitation
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: N acetyl transferase 5
Alternate Names
dJ1002M8.1, dJ1175I6.2 (N-terminal acetyltransferase complex ard1 subunit), EC 2.3.1.88, homolog), N(alpha)-acetyltransferase 20, NatB catalytic subunit, N-acetyltransferase 3 homolog, N-acetyltransferase 5, N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), N-acetyltransferase 5 (GCN5-related, putative), N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, N-alpha-acetyltransferase 20, NatB catalytic subunit, NAT3N-terminal acetyltransferase B complex catalytic subunit NAT5, NAT5dJ1002M8.1 (N-terminal acetyltransferase complex ard1 subunit), NatB complex subunit NAT5, N-terminal acetyltransferase B complex catalytic subunit NAA20, N-terminal acetyltransferase complex ARD1 subunit
Gene Symbol
NAA20
Additional N acetyl transferase 5 Products
Product Documents for N acetyl transferase 5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for N acetyl transferase 5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for N acetyl transferase 5 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review N acetyl transferase 5 Antibody - BSA Free and earn rewards!
Have you used N acetyl transferase 5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...