N-WASP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82512

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit N-WASP Antibody - BSA Free (NBP1-82512) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-N-WASP Antibody: Cited in 7 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for N-WASP Antibody - BSA Free

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining in human cerebral cortex and skeletal muscle tissues. Corresponding WASL RNA-seq data are presented for the same tissues.
Western Blot: N-WASP Antibody [NBP1-82512]

Western Blot: N-WASP Antibody [NBP1-82512]

Western Blot: N-WASP Antibody [NBP1-82512] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: N-WASP Antibody [NBP1-82512]

Immunocytochemistry/ Immunofluorescence: N-WASP Antibody [NBP1-82512]

Immunocytochemistry/Immunofluorescence: N-WASP Antibody [NBP1-82512] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Western Blot: N-WASP Antibody [NBP1-82512]

Western Blot: N-WASP Antibody [NBP1-82512]

Western Blot: N-WASP Antibody [NBP1-82512] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal cells.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human kidney shows moderate to strong positivity in cells in tubules and glomeruli.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human skeletal muscle shows weak positivity in myocytes.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human stomach shows moderate to strong positivity in glandular cells.
Simple Western: N-WASP Antibody [NBP1-82512]

Simple Western: N-WASP Antibody [NBP1-82512]

Simple Western: N-WASP Antibody [NBP1-82512] - Simple Western lane view shows a specific band for N-WASP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
N-WASP Antibody

Western Blot: N-WASP Antibody [NBP1-82512] -

Western Blot: N-WASP Antibody [NBP1-82512] - Generation of nWASP knockdown cell lines. A-549 & SK-MES-1 cells were treated with nWASP siRNA/non-targeting siRNA (NT) at 0.5 μg/ml & then analysed for nWASP expression after 48 h. a QPCR analysis of nWASP transcript expression demonstrates a significant decrease in expression in siRNA treated cells, n = 4 replicates. b PCR also demonstrates a decrease in nWASP expression. c Quantitative analysis of Western blots (n = 4) shows significant decrease in nWASP protein expression in both A-549 & SK-MES1 cell lines after 48 h siRNA treatment. d Representative image showing knockdown of nWASP at protein level in siRNA treated cells at 48 h Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28351346), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
N-WASP Antibody

Western Blot: N-WASP Antibody [NBP1-82512] -

Western Blot: N-WASP Antibody [NBP1-82512] - nWASP activity affects A-549 & SK-MES-1 cell growth. a, b nWASP inhibition using 10 μM wiskostatin treatment significantly impairs the growth of A-549 & SK-MES-1 cells, respectively. c, d A significant effect on growth is also evident after 3 days in nWASP knockdown A-549 & SK-MES-1 cells, respectively, when compared to non-targeting control treated cells Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28351346), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for N-WASP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes

ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 77 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: N-WASP

The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. The WASL gene product is a homolog of WAS protein, however, unlike the latter, it is ubiquitously expressed and shows highest expression in neural tissues. It has been shown to bind Cdc42 directly, and induce formation of long actin microspikes.

Long Name

Neural Wiskott-Aldrich Syndrome Protein

Alternate Names

NWASP, TRS4, WASL

Gene Symbol

WASL

Additional N-WASP Products

Product Documents for N-WASP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for N-WASP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for N-WASP Antibody - BSA Free

Customer Reviews for N-WASP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review N-WASP Antibody - BSA Free and earn rewards!

Have you used N-WASP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...