Nanog Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-21353

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Nanog Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Nanog Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Nanog Antibody [NBP3-21353] -

Immunocytochemistry/Immunofluorescence: Nanog Antibody [NBP3-21353] -

Staining of human cell line SuSa shows localization to nucleoplasm.
Nanog Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: Nanog Antibody - BSA Free [NBP3-21353]

Chromatin Immunoprecipitation-exo-Seq: Nanog Antibody - BSA Free [NBP3-21353]

ChIP-Exo-Seq composite graph for Anti-NANOG (NBP3-21353) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for Nanog Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nanog

Nanog is one of the molecular markers suitable for recognizing the undifferentiated state of stem cells in the mouse and human. Nanog is a divergent homeodomain protein that directs propagation of undifferentiated ES cells. Nanog mRNA is present in pluripotent mouse and human cell lines, and absent from differentiated cells. Nanog-deficient ES cells lose pluripotency and differentiate into extraembryonic endoderm lineage.

Long Name

Nanog Homeobox

Alternate Names

FLJ12581, FLJ40451, hNanog, homeobox protein NANOG, Homeobox transcription factor Nanog, homeobox transcription factor Nanog-delta 48, Nanog homeobox

Gene Symbol

NANOG

Additional Nanog Products

Product Documents for Nanog Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nanog Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nanog Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nanog Antibody - BSA Free and earn rewards!

Have you used Nanog Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies