NAPE-PLD Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88248

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NAPE-PLD Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NAPE-PLD Antibody - BSA Free

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248]

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248]

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248]

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248]

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248]

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248]

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248]

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248]

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP1-88248] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.
NAPE-PLD Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: NAPE-PLD Antibody [NBP1-88248]

Immunocytochemistry/ Immunofluorescence: NAPE-PLD Antibody [NBP1-88248]

Staining of human cell line U-2 OS shows localization to cytosol.

Applications for NAPE-PLD Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NAPE-PLD

NAPE-PLD (also known as N-Acylphosphatidylethanolamine (NAPE)-hydrolyzing phospholipase D) is a membrane-bound phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine. NAPE-PLD has been shown to be expressed by specific populations of neurons in the brain and targeted to axonal processes. Recent studies have suggested that NAEs generated by NAPE-PLD in axons may act as anterograde synaptic signaling molecules that regulate the activity of postsynaptic neurons. NAPE-PLD has also been shown to catalyze the hydrolysis of NAPE to generate OEA (oleoylethanolamide), a natural lipid amide that inhibits food intake in free-feeding rodents by prolonging latency to feed and postmeal interval.

Long Name

N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D

Alternate Names

C7orf18, EC 3.1.4.54, NAPEPLD

Gene Symbol

NAPEPLD

Additional NAPE-PLD Products

Product Documents for NAPE-PLD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NAPE-PLD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NAPE-PLD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NAPE-PLD Antibody - BSA Free and earn rewards!

Have you used NAPE-PLD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies