NASP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33910

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NASP Antibody - BSA Free

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910] - Staining in human testis and pancreas tissues using anti-NASP antibody. Corresponding NASP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910] - Staining of human liver, lymph node, pancreas and testis using Anti-NASP antibody NBP2-33910 (A) shows similar protein distribution across tissues to independent antibody NBP2-33928 (B).
Western Blot: NASP Antibody [NBP2-33910]

Western Blot: NASP Antibody [NBP2-33910]

Western Blot: NASP Antibody [NBP2-33910] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-NASP antibody. Remaining relative intensity is presented.
Western Blot: NASP Antibody [NBP2-33910]

Western Blot: NASP Antibody [NBP2-33910]

Western Blot: NASP Antibody [NBP2-33910] - Analysis in control (vector only transfected HEK293T lysate) and NASP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: NASP Antibody [NBP2-33910]

Immunocytochemistry/ Immunofluorescence: NASP Antibody [NBP2-33910]

Immunocytochemistry/Immunofluorescence: NASP Antibody [NBP2-33910] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910] - Staining of human liver.
Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910]

Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910] - Staining of human lymph node.

Applications for NASP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NASP

NASP is required for DNA replication, normal cell cycle progression, and cell proliferation. It forms a cytoplasmic complex with HSP90 and H1 linker histones and stimulates HSP90 ATPase activity. NASP and H1 histone are subsequently released from the complex and translocate to the nucleus where the histone is released for binding to DNA. [from: http://www.genecards.org/cgi-bin/carddisp.pl®gene=NASP&search=NASP]

Alternate Names

DKFZp547F162, FLB7527, FLJ31599, FLJ35510, histone H1-binding protein, MGC19722, MGC20372, MGC2297, nuclear autoantigenic sperm protein, nuclear autoantigenic sperm protein (histone-binding), PRO1999

Gene Symbol

NASP

UniProt

Additional NASP Products

Product Documents for NASP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NASP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NASP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NASP Antibody - BSA Free and earn rewards!

Have you used NASP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...