NCAPH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88345

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (84%).

Localization

Subcellular

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NCAPH Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NCAPH Antibody [NBP1-88345]

Immunocytochemistry/ Immunofluorescence: NCAPH Antibody [NBP1-88345]

Immunocytochemistry/Immunofluorescence: NCAPH Antibody [NBP1-88345] - Staining of human cell line U-2 OS shows localization to nucleus and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining in human testis and kidney tissues. Corresponding NCAPH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human testis shows positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney shows no positivity as expected.
Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney, skin, testis and tonsil using Anti-NCAPH antibody NBP1-88345 (A) shows similar protein distribution across tissues to independent antibody NBP1-88346 (B).
Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human skin shows nuclear positivity in epidermal cells.
Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human tonsil shows nuclear positivity in germinal center cells.
Simple Western: NCAPH Antibody [NBP1-88345]

Simple Western: NCAPH Antibody [NBP1-88345]

Simple Western: NCAPH Antibody [NBP1-88345] - Simple Western lane view shows a specific band for NCAPH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: NCAPH Antibody [NBP1-88345]

Simple Western: NCAPH Antibody [NBP1-88345]

Simple Western: NCAPH Antibody [NBP1-88345] - Electropherogram image(s) of corresponding Simple Western lane view. NCAPH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).
NCAPH Antibody - BSA Free Western Blot: NCAPH Antibody - BSA Free [NBP1-88345]

Western Blot: NCAPH Antibody - BSA Free [NBP1-88345]

Analysis in human cell lines U2OS and SK-MEL-30 using Anti-NCAPH antibody. Corresponding NCAPH RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
NCAPH Antibody - BSA Free Western Blot: NCAPH Antibody - BSA Free [NBP1-88345]

Western Blot: NCAPH Antibody - BSA Free [NBP1-88345]

Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NCAPH antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
NCAPH Antibody - BSA Free

Western Blot: NCAPH Antibody - BSA Free [NBP1-88345] -

MiR-1976 targets NCAPH 3’-UTR: 1627 bp-1633 bp. A549 and NCI-H1975 cells were transfected with corresponding mimics, respectively and real-time PCR was used to detect the NCAPH mRNA level (A). A549 and NCI-H1975 cells were transfected with corresponding inhibitors, respectively and real-time PCR was used to detect the NCAPH mRNA level (B). Western blot was used to analyze NCAPH protein levels in A549 and NCI-H1975 cells (C, D). A schematic diagram showed the three predicted potential binding sites of miR-1976 at the 3 ' -UTR of NCAPH (E). The luciferase reporter vector containing predicted three binding sites were cloned into pGL3-promoter, namely pGL3-T1, pGL3-T2, and pGL3-T3. The three vectors were co-transfected with miR-1976 mimic respectively into A549 cells, and luciferase signals were detected by luciferase assay (F). The pGL3-T2 was co-transfected with the miR-1976 mimic into A549 cells. Luciferase signals were detected by luciferase assay (G). The pGL3-T2 was co-transfected respectively with the miR-1976 inhibitor into A549 cells. Luciferase signals were detected by luciferase assay (H). The pGL3-T2 was co-transfected with the miR-1976 mimic into A549 cells. The pGL3-T2 mut was co-transfected with the miR-1976 mimic into A549 cells. Luciferase signal was detected by luciferase method (I). * P < 0.05, ** P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-024-61261-6), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NCAPH Antibody - BSA Free

Western Blot: NCAPH Antibody - BSA Free [NBP1-88345] -

NCAPH promotes proliferation &migration and inhibits apoptosis of LUAD cells. NCAPH overexpression/knockdown lentivirus was used to treat A549 and NCI-H1975 cells. NCAPH proteins were detected by western blot assay (A, C) and quantitative analysis (B, D). The viability of LUAD cells was detected by CCK8 assay (E–H). Transwell assays were performed to detect cell migration (I, J). Apoptosis was measured by flow cytometry (K, L). * P < 0.05, ** P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-024-61261-6), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NCAPH Antibody - BSA Free

Western Blot: NCAPH Antibody - BSA Free [NBP1-88345] -

MiR-1976 suppresses tumor growth & metastasis in vivo by targeting NCAPH. A549 cells were infected with the corresponding lentivirus, respectively. About 1 × 107 cells were implanted subcutaneously into nude mice (A), and the tumor volume (B) and weight(C) were observed after cell implantation. NCAPH protein level in xenograft tumor tissues was detected by Western blotting (D, E). In Fig. 7D, the experiments were repeated twice on one membrane (Supplementary information file 2), and Fig. 7D represented one experimental result. The expression of NCAPH, PCNA, and cleaved-caspase-3 in xenograft tumors was detected by IHC staining (F–I). PCNA is a marker of tumor proliferation. A549 cells infected with lentivirus were injected into the tail vein of nude mice (5 in each group) (J). The average number of tumor nodules in each group was calculated (K). HE staining was used to demonstrate tumor nodules (L). * P < 0.05, ** P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-024-61261-6), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NCAPH Antibody - BSA Free

Western Blot: NCAPH Antibody - BSA Free [NBP1-88345] -

NCAPH promotes proliferation &migration and inhibits apoptosis of LUAD cells. NCAPH overexpression/knockdown lentivirus was used to treat A549 and NCI-H1975 cells. NCAPH proteins were detected by western blot assay (A, C) and quantitative analysis (B, D). The viability of LUAD cells was detected by CCK8 assay (E–H). Transwell assays were performed to detect cell migration (I, J). Apoptosis was measured by flow cytometry (K, L). * P < 0.05, ** P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-024-61261-6), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NCAPH Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Simple Western

1:20

Western Blot

0.04 - 0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 127 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NCAPH

NCAPH encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Alternate Names

barren (Drosophila) homolog, barren homolog (Drosophila), barren homolog 1, barren homolog 1 (Drosophila), Barren homolog protein 1, BRRN, BRRN1CAP-H, CAPH, Chromosome-associated protein H, condensin complex subunit 2, HCAP-H, KIAA0074, Non-SMC condensin I complex subunit H, non-SMC condensin I complex, subunit H, XCAP-H homolog

Gene Symbol

NCAPH

Additional NCAPH Products

Product Documents for NCAPH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NCAPH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NCAPH Antibody - BSA Free

Customer Reviews for NCAPH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NCAPH Antibody - BSA Free and earn rewards!

Have you used NCAPH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...