NCAPH Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88345
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEI
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (84%).
Localization
Subcellular
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for NCAPH Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: NCAPH Antibody [NBP1-88345]
Immunocytochemistry/Immunofluorescence: NCAPH Antibody [NBP1-88345] - Staining of human cell line U-2 OS shows localization to nucleus and cytosol. Antibody staining is shown in green.Simple Western: NCAPH Antibody [NBP1-88345]
Simple Western: NCAPH Antibody [NBP1-88345] - Simple Western lane view shows a specific band for NCAPH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: NCAPH Antibody [NBP1-88345]
Simple Western: NCAPH Antibody [NBP1-88345] - Electropherogram image(s) of corresponding Simple Western lane view. NCAPH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).Western Blot: NCAPH Antibody - BSA Free [NBP1-88345] -
MiR-1976 targets NCAPH 3’-UTR: 1627 bp-1633 bp. A549 and NCI-H1975 cells were transfected with corresponding mimics, respectively and real-time PCR was used to detect the NCAPH mRNA level (A). A549 and NCI-H1975 cells were transfected with corresponding inhibitors, respectively and real-time PCR was used to detect the NCAPH mRNA level (B). Western blot was used to analyze NCAPH protein levels in A549 and NCI-H1975 cells (C, D). A schematic diagram showed the three predicted potential binding sites of miR-1976 at the 3 ' -UTR of NCAPH (E). The luciferase reporter vector containing predicted three binding sites were cloned into pGL3-promoter, namely pGL3-T1, pGL3-T2, and pGL3-T3. The three vectors were co-transfected with miR-1976 mimic respectively into A549 cells, and luciferase signals were detected by luciferase assay (F). The pGL3-T2 was co-transfected with the miR-1976 mimic into A549 cells. Luciferase signals were detected by luciferase assay (G). The pGL3-T2 was co-transfected respectively with the miR-1976 inhibitor into A549 cells. Luciferase signals were detected by luciferase assay (H). The pGL3-T2 was co-transfected with the miR-1976 mimic into A549 cells. The pGL3-T2 mut was co-transfected with the miR-1976 mimic into A549 cells. Luciferase signal was detected by luciferase method (I). * P < 0.05, ** P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-024-61261-6), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NCAPH Antibody - BSA Free [NBP1-88345] -
NCAPH promotes proliferation &migration and inhibits apoptosis of LUAD cells. NCAPH overexpression/knockdown lentivirus was used to treat A549 and NCI-H1975 cells. NCAPH proteins were detected by western blot assay (A, C) and quantitative analysis (B, D). The viability of LUAD cells was detected by CCK8 assay (E–H). Transwell assays were performed to detect cell migration (I, J). Apoptosis was measured by flow cytometry (K, L). * P < 0.05, ** P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-024-61261-6), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NCAPH Antibody - BSA Free [NBP1-88345] -
MiR-1976 suppresses tumor growth & metastasis in vivo by targeting NCAPH. A549 cells were infected with the corresponding lentivirus, respectively. About 1 × 107 cells were implanted subcutaneously into nude mice (A), and the tumor volume (B) and weight(C) were observed after cell implantation. NCAPH protein level in xenograft tumor tissues was detected by Western blotting (D, E). In Fig. 7D, the experiments were repeated twice on one membrane (Supplementary information file 2), and Fig. 7D represented one experimental result. The expression of NCAPH, PCNA, and cleaved-caspase-3 in xenograft tumors was detected by IHC staining (F–I). PCNA is a marker of tumor proliferation. A549 cells infected with lentivirus were injected into the tail vein of nude mice (5 in each group) (J). The average number of tumor nodules in each group was calculated (K). HE staining was used to demonstrate tumor nodules (L). * P < 0.05, ** P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-024-61261-6), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NCAPH Antibody - BSA Free [NBP1-88345] -
NCAPH promotes proliferation &migration and inhibits apoptosis of LUAD cells. NCAPH overexpression/knockdown lentivirus was used to treat A549 and NCI-H1975 cells. NCAPH proteins were detected by western blot assay (A, C) and quantitative analysis (B, D). The viability of LUAD cells was detected by CCK8 assay (E–H). Transwell assays were performed to detect cell migration (I, J). Apoptosis was measured by flow cytometry (K, L). * P < 0.05, ** P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-024-61261-6), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]
Staining of human skin shows nuclear positivity in epidermal cells.Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]
Staining of human testis shows positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]
Staining of human tonsil shows nuclear positivity in germinal center cells.Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345]
Staining of human kidney shows no positivity as expected.Applications for NCAPH Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry-Paraffin
1:50 - 1:200
Simple Western
1:20
Western Blot
0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. In
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 127 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 127 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NCAPH
Alternate Names
barren (Drosophila) homolog, barren homolog (Drosophila), barren homolog 1, barren homolog 1 (Drosophila), Barren homolog protein 1, BRRN, BRRN1CAP-H, CAPH, Chromosome-associated protein H, condensin complex subunit 2, HCAP-H, KIAA0074, Non-SMC condensin I complex subunit H, non-SMC condensin I complex, subunit H, XCAP-H homolog
Gene Symbol
NCAPH
Additional NCAPH Products
Product Documents for NCAPH Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NCAPH Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for NCAPH Antibody - BSA Free
Customer Reviews for NCAPH Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NCAPH Antibody - BSA Free and earn rewards!
Have you used NCAPH Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...