Recombinant Human NCCRP1 GST (N-Term) Protein

Novus Biologicals | Catalog # H00342897-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-275 of Human LOC342897

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEEVREGHALGGGMEADGPASLQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPEPAQPSEAHARQLLLEEWGPLSGGLELPQRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPGVRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

57.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human NCCRP1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00342897-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: NCCRP1

Non-specific cytotoxic cells (NCCs) in teleosts and their evolutionary homologue are a subpopulation of lymphocytes with properties that distinguish them from either B- or T-cells. One such property is that NCC/natural killer (NK)/lymphokine activated killer (LAK) cells express spontaneous, non-major histocompatibility complex restricted cytotoxic activity. NCC and LAK lyse a variety of transformed murine and human B-cell, T-cell and myeloid targets. A 32 kDa membrane protein [non-specific cytotoxic cell receptor protein (NCCRP-1)] expressed by NCC and certain mammalian NK/LAK cells mediates this cytotoxicity. NCCRP-1 is evolutionarily conserved and is found in species ranging from marine and freshwater teleosts to higher mammals.

Alternate Names

LOC342897, NCCRP-1, nonspecific cytotoxic cell receptor protein 1 homolog, non-specific cytotoxic cell receptor protein 1 homolog, non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)

Gene Symbol

NCCRP1

Additional NCCRP1 Products

Product Documents for Recombinant Human NCCRP1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human NCCRP1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human NCCRP1 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human NCCRP1 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human NCCRP1 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human NCCRP1 GST (N-Term) Protein

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Is the product NBP2-13642 reactive to fish NCCRP1, specifically carp?

    A:

    The immunogen of NCCRP1 antibody NBP2-13642 is less than 65% homologous to carp, so we would not recommend this antibody for your purposes. However, NCCRP1 antibody NB100-2071 may be suitable, as it has been validated in catfish.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...