NDRG2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55431

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDRG2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NDRG2(NDRG family member 2) The peptide sequence was selected from the C terminal of NDRG2. Peptide sequence GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NDRG2 Antibody - BSA Free

Western Blot: NDRG2 Antibody [NBP1-55431]

Western Blot: NDRG2 Antibody [NBP1-55431]

Western Blot: NDRG2 Antibody [NBP1-55431] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-55431]

Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-55431]

Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-55431] - Human Liver tissue, 5 ug/ml.

Applications for NDRG2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDRG2

NDRG2s gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Alternate Names

DKFZp781G1938, FLJ25522, KIAA1248cytoplasmic protein Ndr1, NDR1-related protein NDR2, NDRG family member 2, protein NDRG2, Protein Syld709613, syld709613 protein, SYLDN-myc downstream regulator 2

Gene Symbol

NDRG2

Additional NDRG2 Products

Product Documents for NDRG2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDRG2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDRG2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDRG2 Antibody - BSA Free and earn rewards!

Have you used NDRG2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies