NDUFC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88934

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDUFC2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFC2 Antibody - BSA Free

Western Blot: NDUFC2 Antibody [NBP1-88934]

Western Blot: NDUFC2 Antibody [NBP1-88934]

Western Blot: NDUFC2 Antibody [NBP1-88934] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2
Immunohistochemistry: NDUFC2 Antibody [NBP1-88934]

Immunohistochemistry: NDUFC2 Antibody [NBP1-88934]

Immunohistochemistry: NDUFC2 Antibody [NBP1-88934] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Simple Western: NDUFC2 Antibody [NBP1-88934]

Simple Western: NDUFC2 Antibody [NBP1-88934]

Simple Western: NDUFC2 Antibody [NBP1-88934] - Simple Western lane view shows a specific band for NDUFC2 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.
Simple Western: NDUFC2 Antibody [NBP1-88934]

Simple Western: NDUFC2 Antibody [NBP1-88934]

Simple Western: NDUFC2 Antibody [NBP1-88934] - Electropherogram image of the corresponding Simple Western lane view. NDUFC2 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.

Applications for NDUFC2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.In Simple Western only 10-15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in HT-29 and HCT 116 lysates, separated by Size, antibody dilution of 1:10

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFC2

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Alternate Names

B14.5b, CI-B14.5b, complex I subunit B14.5b, Complex I-B14.5b, HLC-1NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 (14.5kD, B14.5b), Human lung cancer oncogene 1 protein, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa, NADH dehydrogenase [ubiquinone] 1 subunit C2, NADHDH2, NADH-ubiquinone oxidoreductase subunit B14.5b

Gene Symbol

NDUFC2

Additional NDUFC2 Products

Product Documents for NDUFC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFC2 Antibody - BSA Free and earn rewards!

Have you used NDUFC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies