NET1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13653

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NET1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: PSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NET1 Antibody - BSA Free

Western Blot: NET1 Antibody [NBP2-13653]

Western Blot: NET1 Antibody [NBP2-13653]

Western Blot: NET1 Antibody [NBP2-13653] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-380
Immunocytochemistry/ Immunofluorescence: NET1 Antibody [NBP2-13653]

Immunocytochemistry/ Immunofluorescence: NET1 Antibody [NBP2-13653]

Immunocytochemistry/Immunofluorescence: NET1 Antibody [NBP2-13653] - Staining of human cell line HaCaT shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: NET1 Antibody [NBP2-13653]

Immunohistochemistry-Paraffin: NET1 Antibody [NBP2-13653]

Immunohistochemistry-Paraffin: NET1 Antibody [NBP2-13653] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Applications for NET1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NET1

NET1 is a guanyl nucleotide exchange factor for RhoA GTPase. It may be involved in signal transduction, in the activation of the SAPK/JNK pathway.

Alternate Names

ARHGEF8neuroepithelial cell-transforming gene 1 protein, guanine nucleotide regulatory protein (oncogene), NET1A, neuroepithelial cell transforming 1, neuroepithelial cell transforming gene 1, neuroepithelioma transforming gene 1, p65 Net1 proto-oncogene protein, Proto-oncogene p65 Net1, Rho guanine nucleotide exchange factor (GEF) 8, Rho guanine nucleotide exchange factor 8, small GTP-binding protein regulator

Gene Symbol

NET1

Additional NET1 Products

Product Documents for NET1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NET1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NET1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NET1 Antibody - BSA Free and earn rewards!

Have you used NET1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies