NeuroD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88661

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (97%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NeuroD1 Antibody - BSA Free

Western Blot: NeuroD1 Antibody [NBP1-88661]

Western Blot: NeuroD1 Antibody [NBP1-88661]

Western Blot: NeuroD1 Antibody [NBP1-88661] - Analysis in control (vector only transfected HEK293T lysate) and NEUROD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
NeuroD1 Antibody

Western Blot: NeuroD1 Antibody [NBP1-88661] -

nbp1-88661_rabbit-polyclonal-neurod1-antibody-20920231412573.jpg
NeuroD1 Antibody

Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] -

nbp1-88661_rabbit-polyclonal-neurod1-antibody-2092023181150.jpg
NeuroD1 Antibody

Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] -

Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - IHC of the co-expression of key molecules other than ASCL1 in SCLC samples. Serial section immunostaining for NEUROD1 (A) & YAP1 (B): SCLC cell nuclei were positive for NEUROD1 (A), & the cytoplasm was positive for YAP1 (B). Serial section immunostaining for NEUROD1 (C) & POU2F31 (D): SCLC cell nuclei were positive for NEUROD1 (C), & the cytoplasm was positive for POU2F3 (D). The cytoplasm of SCLC cells was positive for YAP1 (E) & POU2F3 (F). Scale bar = 100 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NeuroD1 Antibody

Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] -

Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - IHC of the co-expression of key molecules other than ASCL1 in SCLC samples. Serial section immunostaining for NEUROD1 (A) & YAP1 (B): SCLC cell nuclei were positive for NEUROD1 (A), & the cytoplasm was positive for YAP1 (B). Serial section immunostaining for NEUROD1 (C) & POU2F31 (D): SCLC cell nuclei were positive for NEUROD1 (C), & the cytoplasm was positive for POU2F3 (D). The cytoplasm of SCLC cells was positive for YAP1 (E) & POU2F3 (F). Scale bar = 100 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NeuroD1 Antibody

Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] -

Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of four key molecules by WB & IHC in SCLC samples. (A) Example of the positive control of the four key molecules by WB in SCLC cell lines. ASCL1 was strongly expressed in H209 cells. NeuroD1 was strongly expressed in H82 cells. Pou2F3 was strongly expressed in H526 cells & weakly expressed in H82 & SBC3 cells. YAP1 was strongly expressed in SBC3 cells. beta -actin served as an internal control. (B) Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. ASCL1 staining was found in tumor cell nuclei of H209 cells. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Pou2F3 staining with a diffuse cytoplasmic pattern was found in H82, H526, & SBC3 cells. The Pou2F3 staining intensity was weak in H82 & SBC3 cells & strong in H526 cells. YAP1 was stained with a membranous pattern in SBC3 cells. Scale bar = 50 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NeuroD1 Antibody

Western Blot: NeuroD1 Antibody [NBP1-88661] -

Western Blot: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of four key molecules by WB & IHC in SCLC samples. (A) Example of the positive control of the four key molecules by WB in SCLC cell lines. ASCL1 was strongly expressed in H209 cells. NeuroD1 was strongly expressed in H82 cells. Pou2F3 was strongly expressed in H526 cells & weakly expressed in H82 & SBC3 cells. YAP1 was strongly expressed in SBC3 cells. beta -actin served as an internal control. (B) Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. ASCL1 staining was found in tumor cell nuclei of H209 cells. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Pou2F3 staining with a diffuse cytoplasmic pattern was found in H82, H526, & SBC3 cells. The Pou2F3 staining intensity was weak in H82 & SBC3 cells & strong in H526 cells. YAP1 was stained with a membranous pattern in SBC3 cells. Scale bar = 50 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NeuroD1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

Validated for Immunohistochemistry from CiteAb

Western Blot

0.04 - 0.4 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NeuroD1

NeuroD1 encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus.

Long Name

Neurogenic Differentiation Factor 1

Alternate Names

BETA2, BHF-1, NIDDM

Gene Symbol

NEUROD1

Additional NeuroD1 Products

Product Documents for NeuroD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NeuroD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NeuroD1 Antibody - BSA Free

Customer Reviews for NeuroD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NeuroD1 Antibody - BSA Free and earn rewards!

Have you used NeuroD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies