NeuroD1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88661
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for NeuroD1 Antibody - BSA Free
Western Blot: NeuroD1 Antibody [NBP1-88661]
Western Blot: NeuroD1 Antibody [NBP1-88661] - Analysis in control (vector only transfected HEK293T lysate) and NEUROD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Western Blot: NeuroD1 Antibody [NBP1-88661] -
nbp1-88661_rabbit-polyclonal-neurod1-antibody-20920231412573.jpgImmunohistochemistry: NeuroD1 Antibody [NBP1-88661] -
nbp1-88661_rabbit-polyclonal-neurod1-antibody-2092023181150.jpgImmunohistochemistry: NeuroD1 Antibody [NBP1-88661] -
Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - IHC of the co-expression of key molecules other than ASCL1 in SCLC samples. Serial section immunostaining for NEUROD1 (A) & YAP1 (B): SCLC cell nuclei were positive for NEUROD1 (A), & the cytoplasm was positive for YAP1 (B). Serial section immunostaining for NEUROD1 (C) & POU2F31 (D): SCLC cell nuclei were positive for NEUROD1 (C), & the cytoplasm was positive for POU2F3 (D). The cytoplasm of SCLC cells was positive for YAP1 (E) & POU2F3 (F). Scale bar = 100 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] -
Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - IHC of the co-expression of key molecules other than ASCL1 in SCLC samples. Serial section immunostaining for NEUROD1 (A) & YAP1 (B): SCLC cell nuclei were positive for NEUROD1 (A), & the cytoplasm was positive for YAP1 (B). Serial section immunostaining for NEUROD1 (C) & POU2F31 (D): SCLC cell nuclei were positive for NEUROD1 (C), & the cytoplasm was positive for POU2F3 (D). The cytoplasm of SCLC cells was positive for YAP1 (E) & POU2F3 (F). Scale bar = 100 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] -
Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of four key molecules by WB & IHC in SCLC samples. (A) Example of the positive control of the four key molecules by WB in SCLC cell lines. ASCL1 was strongly expressed in H209 cells. NeuroD1 was strongly expressed in H82 cells. Pou2F3 was strongly expressed in H526 cells & weakly expressed in H82 & SBC3 cells. YAP1 was strongly expressed in SBC3 cells. beta -actin served as an internal control. (B) Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. ASCL1 staining was found in tumor cell nuclei of H209 cells. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Pou2F3 staining with a diffuse cytoplasmic pattern was found in H82, H526, & SBC3 cells. The Pou2F3 staining intensity was weak in H82 & SBC3 cells & strong in H526 cells. YAP1 was stained with a membranous pattern in SBC3 cells. Scale bar = 50 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NeuroD1 Antibody [NBP1-88661] -
Western Blot: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of four key molecules by WB & IHC in SCLC samples. (A) Example of the positive control of the four key molecules by WB in SCLC cell lines. ASCL1 was strongly expressed in H209 cells. NeuroD1 was strongly expressed in H82 cells. Pou2F3 was strongly expressed in H526 cells & weakly expressed in H82 & SBC3 cells. YAP1 was strongly expressed in SBC3 cells. beta -actin served as an internal control. (B) Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. ASCL1 staining was found in tumor cell nuclei of H209 cells. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Pou2F3 staining with a diffuse cytoplasmic pattern was found in H82, H526, & SBC3 cells. The Pou2F3 staining intensity was weak in H82 & SBC3 cells & strong in H526 cells. YAP1 was stained with a membranous pattern in SBC3 cells. Scale bar = 50 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for NeuroD1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
Validated for Immunohistochemistry from CiteAb
Western Blot
0.04 - 0.4 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NeuroD1
Long Name
Neurogenic Differentiation Factor 1
Alternate Names
BETA2, BHF-1, NIDDM
Gene Symbol
NEUROD1
Additional NeuroD1 Products
Product Documents for NeuroD1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NeuroD1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for NeuroD1 Antibody - BSA Free
Customer Reviews for NeuroD1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NeuroD1 Antibody - BSA Free and earn rewards!
Have you used NeuroD1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars